Cp4.1LG09g01610 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ACCATAATGTCGTCCAGAAGCTCGCGTTCTAGGCGCTCATCTGTGCCTTCTAGCAACATTTCTGATGAACAAATTGCTGATTTGATCTCCAAGTTACAGCAACTCATCCCTGAGATTCGCAATGCCCGTTCCTCCTCCAGGGTATCTCTGTTTTTCTACACTCTGTTCATGTTTATTTCAGAAATGGGTTACACCCACGATCTCATTCTTCTTAATTTGTGGGGTTTTATAGGTATCAGCTTCAAAGGTTCTTCAAGAGACCTGCAACTACATAAGAAGCTTACAAAGAGAGGTGGGCGACTTAAGCGACCGATTATCAGAGCTGTTGCTATCAACTGACCCTGAAAGTGCTCAGGCTGCCATTATTAGAAGCTTACTCATGTAA ACCATAATGTCGTCCAGAAGCTCGCGTTCTAGGCGCTCATCTGTGCCTTCTAGCAACATTTCTGATGAACAAATTGCTGATTTGATCTCCAAGTTACAGCAACTCATCCCTGAGATTCGCAATGCCCGTTCCTCCTCCAGGGTATCAGCTTCAAAGGTTCTTCAAGAGACCTGCAACTACATAAGAAGCTTACAAAGAGAGGTGGGCGACTTAAGCGACCGATTATCAGAGCTGTTGCTATCAACTGACCCTGAAAGTGCTCAGGCTGCCATTATTAGAAGCTTACTCATGTAA ACCATAATGTCGTCCAGAAGCTCGCGTTCTAGGCGCTCATCTGTGCCTTCTAGCAACATTTCTGATGAACAAATTGCTGATTTGATCTCCAAGTTACAGCAACTCATCCCTGAGATTCGCAATGCCCGTTCCTCCTCCAGGGTATCAGCTTCAAAGGTTCTTCAAGAGACCTGCAACTACATAAGAAGCTTACAAAGAGAGGTGGGCGACTTAAGCGACCGATTATCAGAGCTGTTGCTATCAACTGACCCTGAAAGTGCTCAGGCTGCCATTATTAGAAGCTTACTCATGTAA TIMSSRSSRSRRSSVPSSNISDEQIADLISKLQQLIPEIRNARSSSRVSASKVLQETCNYIRSLQREVGDLSDRLSELLLSTDPESAQAAIIRSLLM
BLAST of Cp4.1LG09g01610 vs. Swiss-Prot
Match: PRE6_ARATH (Transcription factor PRE6 OS=Arabidopsis thaliana GN=PRE6 PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.4e-25 Identity = 70/93 (75.27%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. Swiss-Prot
Match: ILI6_ORYSJ (Transcription factor ILI6 OS=Oryza sativa subsp. japonica GN=ILI6 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.3e-23 Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. Swiss-Prot
Match: ILI6_ORYSI (Transcription factor ILI6 OS=Oryza sativa subsp. indica GN=ILI6 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.3e-23 Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. Swiss-Prot
Match: PRE2_ARATH (Transcription factor PRE2 OS=Arabidopsis thaliana GN=PRE2 PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.0e-23 Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. Swiss-Prot
Match: PRE3_ARATH (Transcription factor PRE3 OS=Arabidopsis thaliana GN=PRE3 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.5e-22 Identity = 62/94 (65.96%), Postives = 80/94 (85.11%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TrEMBL
Match: A0A0A0KQJ7_CUCSA (Transcription regulator OS=Cucumis sativus GN=Csa_5G604940 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.0e-34 Identity = 88/95 (92.63%), Postives = 88/95 (92.63%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TrEMBL
Match: B9S289_RICCO (Transcription regulator, putative OS=Ricinus communis GN=RCOM_0697210 PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.3e-25 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TrEMBL
Match: M5XQD9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa016030mg PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 74/95 (77.89%), Postives = 80/95 (84.21%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TrEMBL
Match: A0A022Q496_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a017116mg PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 6.4e-25 Identity = 74/95 (77.89%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TrEMBL
Match: A5BU53_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0026g02030 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 74/95 (77.89%), Postives = 80/95 (84.21%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TAIR10
Match: AT1G26945.1 (AT1G26945.1 basic helix-loop-helix (bHLH) DNA-binding superfamily protein) HSP 1 Score: 114.8 bits (286), Expect = 3.0e-26 Identity = 70/93 (75.27%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TAIR10
Match: AT5G15160.1 (AT5G15160.1 BANQUO 2) HSP 1 Score: 108.2 bits (269), Expect = 2.8e-24 Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TAIR10
Match: AT1G74500.1 (AT1G74500.1 activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1) HSP 1 Score: 104.0 bits (258), Expect = 5.3e-23 Identity = 62/94 (65.96%), Postives = 80/94 (85.11%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TAIR10
Match: AT3G28857.1 (AT3G28857.1 basic helix-loop-helix (bHLH) DNA-binding family protein) HSP 1 Score: 103.2 bits (256), Expect = 9.1e-23 Identity = 57/91 (62.64%), Postives = 71/91 (78.02%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. TAIR10
Match: AT3G47710.1 (AT3G47710.1 BANQUO 3) HSP 1 Score: 100.5 bits (249), Expect = 5.9e-22 Identity = 61/95 (64.21%), Postives = 78/95 (82.11%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. NCBI nr
Match: gi|449434802|ref|XP_004135185.1| (PREDICTED: transcription factor PRE6-like [Cucumis sativus]) HSP 1 Score: 152.9 bits (385), Expect = 2.8e-34 Identity = 88/95 (92.63%), Postives = 88/95 (92.63%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. NCBI nr
Match: gi|659091031|ref|XP_008446331.1| (PREDICTED: transcription factor PRE6-like [Cucumis melo]) HSP 1 Score: 151.8 bits (382), Expect = 6.3e-34 Identity = 87/95 (91.58%), Postives = 88/95 (92.63%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. NCBI nr
Match: gi|747049918|ref|XP_011071014.1| (PREDICTED: transcription factor PRE6-like [Sesamum indicum]) HSP 1 Score: 125.9 bits (315), Expect = 3.7e-26 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. NCBI nr
Match: gi|1009179433|ref|XP_015871076.1| (PREDICTED: transcription factor PRE6-like [Ziziphus jujuba]) HSP 1 Score: 125.6 bits (314), Expect = 4.9e-26 Identity = 74/95 (77.89%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG09g01610 vs. NCBI nr
Match: gi|255558162|ref|XP_002520108.1| (PREDICTED: transcription factor PRE6 [Ricinus communis]) HSP 1 Score: 123.6 bits (309), Expect = 1.8e-25 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|