Cp4.1LG09g01400 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTTATGTCACCGGATAATTACACTTTCAATTTTTTGGTTCGTACTAGCGCTCAGTTATCTGCTTGCGAAGCAGGTCGAACTGTTCATGGTGCTCTTTTCAAACATGGGTTTGAATTTGACCCACATGTTCAAAGTGGGTTGATCTTTATGTATGCTGAAATGGGTTGCTTGAATTCATGCTATCGTGTGTTTGAATCAGTTCAGAATCCGGATGTAGTTTGTCAGACGGCCATGGTGAGCGCTTGCGCCAAATGTGGGGATACTGACTATGCACGACAACTGTTCGACGAAATGCCTCAGAGAGACTCTGTATCATGGAATGCTATGATTGCTGGCTATGCACAGAGGGGGCAATCAAGGGAAGCTTTAAATCTGTTTAAGCTAATGCAAATGGATGGTGTCAAGGTCAATGAGGTGTCTATGGTTTCTGTTTTAACAGCCTGCACTCACTTGGGTGCACTAG ATGATCGCTCAGTTATCTGCTTGCGAAGCAGGTCGAACTGTTCATGGTGCTCTTTTCAAACATGGGTTTGAATTTGACCCACATGTTCAAAGTGGGTTGATCTTTATGTATGCTGAAATGGGTTGCTTGAATTCATGCTATCGTGTGTTTGAATCAGTTCAGAATCCGGATGTAGTTTGTCAGACGGCCATGGTGAGCGCTTGCGCCAAATGTGGGGATACTGACTATGCACGACAACTGTTCGACGAAATGCCTCAGAGAGACTCTGTATCATGGAATGCTATGATTGCTGGCTATGCACAGAGGGGGCAATCAAGGGAAGCTTTAAATCTGTTTAAGCTAATGCAAATGGATGGTGTCAAGGTCAATGAGCCTGCACTCACTTGGGTGCACTAG ATGATCGCTCAGTTATCTGCTTGCGAAGCAGGTCGAACTGTTCATGGTGCTCTTTTCAAACATGGGTTTGAATTTGACCCACATGTTCAAAGTGGGTTGATCTTTATGTATGCTGAAATGGGTTGCTTGAATTCATGCTATCGTGTGTTTGAATCAGTTCAGAATCCGGATGTAGTTTGTCAGACGGCCATGGTGAGCGCTTGCGCCAAATGTGGGGATACTGACTATGCACGACAACTGTTCGACGAAATGCCTCAGAGAGACTCTGTATCATGGAATGCTATGATTGCTGGCTATGCACAGAGGGGGCAATCAAGGGAAGCTTTAAATCTGTTTAAGCTAATGCAAATGGATGGTGTCAAGGTCAATGAGCCTGCACTCACTTGGGTGCACTAG MIAQLSACEAGRTVHGALFKHGFEFDPHVQSGLIFMYAEMGCLNSCYRVFESVQNPDVVCQTAMVSACAKCGDTDYARQLFDEMPQRDSVSWNAMIAGYAQRGQSREALNLFKLMQMDGVKVNEPALTWVH
BLAST of Cp4.1LG09g01400 vs. Swiss-Prot
Match: PP410_ARATH (Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 3.2e-41 Identity = 74/119 (62.18%), Postives = 98/119 (82.35%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. Swiss-Prot
Match: PP200_ARATH (Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-22 Identity = 49/118 (41.53%), Postives = 74/118 (62.71%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. Swiss-Prot
Match: PPR21_ARATH (Pentatricopeptide repeat-containing protein At1g08070, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.8e-22 Identity = 52/128 (40.62%), Postives = 78/128 (60.94%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. Swiss-Prot
Match: PP367_ARATH (Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 9.2e-20 Identity = 45/128 (35.16%), Postives = 75/128 (58.59%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. Swiss-Prot
Match: PP354_ARATH (Pentatricopeptide repeat-containing protein ELI1, chloroplastic OS=Arabidopsis thaliana GN=ELI1 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.6e-19 Identity = 48/117 (41.03%), Postives = 73/117 (62.39%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TrEMBL
Match: A0A0A0KSJ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G604190 PE=4 SV=1) HSP 1 Score: 219.9 bits (559), Expect = 1.8e-54 Identity = 102/122 (83.61%), Postives = 110/122 (90.16%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TrEMBL
Match: M5XCT1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa003120mg PE=4 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 4.7e-47 Identity = 91/128 (71.09%), Postives = 107/128 (83.59%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TrEMBL
Match: K7L9R1_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 2.0e-45 Identity = 85/128 (66.41%), Postives = 107/128 (83.59%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TrEMBL
Match: W9R9L3_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_021080 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 2.0e-45 Identity = 91/128 (71.09%), Postives = 104/128 (81.25%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TrEMBL
Match: A0A0B2PVW4_GLYSO (Putative pentatricopeptide repeat-containing protein OS=Glycine soja GN=glysoja_029582 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 2.0e-45 Identity = 85/128 (66.41%), Postives = 107/128 (83.59%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TAIR10
Match: AT5G40405.1 (AT5G40405.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 169.1 bits (427), Expect = 1.8e-42 Identity = 74/119 (62.18%), Postives = 98/119 (82.35%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TAIR10
Match: AT2G42920.1 (AT2G42920.1 Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 107.5 bits (267), Expect = 6.5e-24 Identity = 49/118 (41.53%), Postives = 74/118 (62.71%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TAIR10
Match: AT1G08070.1 (AT1G08070.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 104.4 bits (259), Expect = 5.5e-23 Identity = 52/128 (40.62%), Postives = 78/128 (60.94%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TAIR10
Match: AT5G06540.1 (AT5G06540.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 97.8 bits (242), Expect = 5.2e-21 Identity = 45/128 (35.16%), Postives = 75/128 (58.59%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. TAIR10
Match: AT4G37380.1 (AT4G37380.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 95.5 bits (236), Expect = 2.6e-20 Identity = 48/117 (41.03%), Postives = 73/117 (62.39%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. NCBI nr
Match: gi|659090971|ref|XP_008446300.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Cucumis melo]) HSP 1 Score: 221.5 bits (563), Expect = 8.8e-55 Identity = 103/125 (82.40%), Postives = 112/125 (89.60%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. NCBI nr
Match: gi|449435364|ref|XP_004135465.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Cucumis sativus]) HSP 1 Score: 219.9 bits (559), Expect = 2.6e-54 Identity = 102/122 (83.61%), Postives = 110/122 (90.16%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. NCBI nr
Match: gi|700196697|gb|KGN51874.1| (hypothetical protein Csa_5G604190 [Cucumis sativus]) HSP 1 Score: 219.9 bits (559), Expect = 2.6e-54 Identity = 102/122 (83.61%), Postives = 110/122 (90.16%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. NCBI nr
Match: gi|657994461|ref|XP_008389535.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Malus domestica]) HSP 1 Score: 197.6 bits (501), Expect = 1.4e-47 Identity = 93/128 (72.66%), Postives = 106/128 (82.81%), Query Frame = 1
BLAST of Cp4.1LG09g01400 vs. NCBI nr
Match: gi|645229921|ref|XP_008221687.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Prunus mume]) HSP 1 Score: 196.8 bits (499), Expect = 2.3e-47 Identity = 92/128 (71.88%), Postives = 108/128 (84.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |