Cp4.1LG07g03610 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGAAGTGGACGATTGCTTCTGCTCTTCTCCTTCTTTGTTTTCTCTCTCTCGTACCGGATCAAGGTGTGATTTCGATTCTTATTTGAGCCATTTTGATTTATTTGTTGAAATGCGCATCGAATGTTTCTTGCATTATGTTATTGTCGATGTTTGAGGTTTTAATTTCTGAGGCTCGGGAAGAAATTTGGACGAGATTTGAGCTCTTTTTGGACTGTGAAATTTGTGGTGATATTGTTTCATTATGTTTCTCTCGTTTTTGGGTGTTTAGGTCCTAGATTTCATGCCAAGGCCGATGGTGACGCCGACGAGGTTGTAGATCCACCGAAGGTTGAGGAAAAAATCGGGGCCGTTCCACATGGTCTCTCTACTGATTCTGATGTTGTCAAGAGGTTCGTGAATATCTAA ATGAGGAAGTGGACGATTGCTTCTGCTCTTCTCCTTCTTTGTTTTCTCTCTCTCGTACCGGATCAAGGTCCTAGATTTCATGCCAAGGCCGATGGTGACGCCGACGAGGTTGTAGATCCACCGAAGGTTGAGGAAAAAATCGGGGCCGTTCCACATGGTCTCTCTACTGATTCTGATGTTGTCAAGAGGTTCGTGAATATCTAA ATGAGGAAGTGGACGATTGCTTCTGCTCTTCTCCTTCTTTGTTTTCTCTCTCTCGTACCGGATCAAGGTCCTAGATTTCATGCCAAGGCCGATGGTGACGCCGACGAGGTTGTAGATCCACCGAAGGTTGAGGAAAAAATCGGGGCCGTTCCACATGGTCTCTCTACTGATTCTGATGTTGTCAAGAGGTTCGTGAATATCTAA MRKWTIASALLLLCFLSLVPDQGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDVVKRFVNI
BLAST of Cp4.1LG07g03610 vs. Swiss-Prot
Match: ENPL_CATRO (Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.0e-15 Identity = 40/63 (63.49%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. Swiss-Prot
Match: ENPL_HORVU (Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 6.6e-14 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. Swiss-Prot
Match: ENPL_ARATH (Endoplasmin homolog OS=Arabidopsis thaliana GN=HSP90-7 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.1e-12 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TrEMBL
Match: A0A0A0LPH1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G368880 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 5.2e-26 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TrEMBL
Match: A0A151R836_CAJCA (Endoplasmin isogeny OS=Cajanus cajan GN=KK1_039948 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.5e-20 Identity = 49/63 (77.78%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TrEMBL
Match: A0A140GBF6_9ROSI (HSP90 OS=Populus alba x Populus glandulosa PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.3e-20 Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TrEMBL
Match: B9H4Z6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0005s26260g PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.2e-19 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TrEMBL
Match: A0A0B2PYI4_GLYSO (Endoplasmin like OS=Glycine soja GN=glysoja_008600 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-19 Identity = 49/63 (77.78%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. TAIR10
Match: AT4G24190.1 (AT4G24190.1 Chaperone protein htpG family protein) HSP 1 Score: 72.4 bits (176), Expect = 1.2e-13 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. NCBI nr
Match: gi|659088135|ref|XP_008444821.1| (PREDICTED: endoplasmin homolog [Cucumis melo]) HSP 1 Score: 127.9 bits (320), Expect = 6.8e-27 Identity = 61/63 (96.83%), Postives = 62/63 (98.41%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. NCBI nr
Match: gi|449469875|ref|XP_004152644.1| (PREDICTED: endoplasmin homolog [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 7.5e-26 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. NCBI nr
Match: gi|1012327031|gb|KYP38780.1| (Endoplasmin isogeny [Cajanus cajan]) HSP 1 Score: 105.5 bits (262), Expect = 3.6e-20 Identity = 49/63 (77.78%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. NCBI nr
Match: gi|1002096742|gb|AMM72795.1| (HSP90 [Populus alba x Populus glandulosa]) HSP 1 Score: 104.0 bits (258), Expect = 1.0e-19 Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cp4.1LG07g03610 vs. NCBI nr
Match: gi|224085900|ref|XP_002307732.1| (hypothetical protein POPTR_0005s26260g [Populus trichocarpa]) HSP 1 Score: 103.2 bits (256), Expect = 1.8e-19 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |