Cp4.1LG05g06760 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AAGGAGAAGGAGACGGAGATGGAGATGGAGATGGAGATGGATGAAGAAATGGAAGAGGTTACTGATCAGCCATTTGATTCGGATGAGATTGATTTCGATTACGAGTTTGATGCCGCCATGTATTACGATTTCACTCGCCCCGAGACAGAGATGGAGATGAGAGGAGCCGAGGATTGGTTTAAATTCGCTGGAACCTATCCACCTTCTCGTAAGCATTTTGTTTTCTTATGGATCATTTGACTCTTCGCGATTTCGATTTTATTGGATATCTGTTACAAATGTTGAAGTTATGGAATTATTCTGTTCTGCGGAATTTGATTTTTGACGACAACGCTTTCTCTTGGAATAGTTTTTAGTGCATTATGGTTTCATGGGAATAAAATCCAATTATTTTGGAGAGTAAATCAAAATCTAATTGGTCTTTCATGTTGATTCTTATGCCATGATTTTTTCTTTCGTCTTTTAGCATTCGTCGTAAAATTGACTGGGGAAAAAGAGGCGCGGGCAGAGTGCACCTCTATTGAACTCAAAGGTGTCCAGAACAACCGGGAGGACCCTGAAAATTCAGGTATAATGTGCATTTCTTCTTTTATTATTCGTTCAGTTGGATTCAACCTCGGCAATATGCTGTGCCAGAAGAGCTATTTTAATAGTTAA AAGGAGAAGGAGACGGAGATGGAGATGGAGATGGAGATGGATGAAGAAATGGAAGAGGTTACTGATCAGCCATTTGATTCGGATGAGATTGATTTCGATTACGAGTTTGATGCCGCCATGTATTACGATTTCACTCGCCCCGAGACAGAGATGGAGATGAGAGGAGCCGAGGATTGGTTTAAATTCGCTGGAACCTATCCACCTTCTCCATTCGTCGTAAAATTGACTGGGGAAAAAGAGGCGCGGGCAGAGTGCACCTCTATTGAACTCAAAGGTGTCCAGAACAACCGGGAGGACCCTGAAAATTCAGTTGGATTCAACCTCGGCAATATGCTGTGCCAGAAGAGCTATTTTAATAGTTAA AAGGAGAAGGAGACGGAGATGGAGATGGAGATGGAGATGGATGAAGAAATGGAAGAGGTTACTGATCAGCCATTTGATTCGGATGAGATTGATTTCGATTACGAGTTTGATGCCGCCATGTATTACGATTTCACTCGCCCCGAGACAGAGATGGAGATGAGAGGAGCCGAGGATTGGTTTAAATTCGCTGGAACCTATCCACCTTCTCCATTCGTCGTAAAATTGACTGGGGAAAAAGAGGCGCGGGCAGAGTGCACCTCTATTGAACTCAAAGGTGTCCAGAACAACCGGGAGGACCCTGAAAATTCAGTTGGATTCAACCTCGGCAATATGCTGTGCCAGAAGAGCTATTTTAATAGTTAA KEKETEMEMEMEMDEEMEEVTDQPFDSDEIDFDYEFDAAMYYDFTRPETEMEMRGAEDWFKFAGTYPPSPFVVKLTGEKEARAECTSIELKGVQNNREDPENSVGFNLGNMLCQKSYFNS
BLAST of Cp4.1LG05g06760 vs. TrEMBL
Match: A0A0A0K5I1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G229900 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 3.1e-29 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TrEMBL
Match: M5X9B2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa019113mg PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.8e-13 Identity = 41/91 (45.05%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TrEMBL
Match: B9RBW2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1681670 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.2e-12 Identity = 51/111 (45.95%), Postives = 67/111 (60.36%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TrEMBL
Match: A0A067JRU9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_20724 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.5e-12 Identity = 44/81 (54.32%), Postives = 57/81 (70.37%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TrEMBL
Match: W9RYK0_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_023171 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.7e-11 Identity = 43/89 (48.31%), Postives = 58/89 (65.17%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TAIR10
Match: AT4G22860.1 (AT4G22860.1 Cell cycle regulated microtubule associated protein) HSP 1 Score: 68.2 bits (165), Expect = 4.0e-12 Identity = 38/70 (54.29%), Postives = 46/70 (65.71%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TAIR10
Match: AT4G11990.1 (AT4G11990.1 Cell cycle regulated microtubule associated protein) HSP 1 Score: 67.4 bits (163), Expect = 6.9e-12 Identity = 45/118 (38.14%), Postives = 67/118 (56.78%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. TAIR10
Match: AT5G07170.1 (AT5G07170.1 Cell cycle regulated microtubule associated protein) HSP 1 Score: 60.8 bits (146), Expect = 6.4e-10 Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. NCBI nr
Match: gi|778725796|ref|XP_011659005.1| (PREDICTED: protein TPX2-like isoform X2 [Cucumis sativus]) HSP 1 Score: 136.0 bits (341), Expect = 4.5e-29 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. NCBI nr
Match: gi|700188981|gb|KGN44214.1| (hypothetical protein Csa_7G229900 [Cucumis sativus]) HSP 1 Score: 136.0 bits (341), Expect = 4.5e-29 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. NCBI nr
Match: gi|778725790|ref|XP_011659002.1| (PREDICTED: protein TPX2-like isoform X1 [Cucumis sativus]) HSP 1 Score: 136.0 bits (341), Expect = 4.5e-29 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. NCBI nr
Match: gi|645257597|ref|XP_008234482.1| (PREDICTED: uncharacterized protein LOC103333434 [Prunus mume]) HSP 1 Score: 87.8 bits (216), Expect = 1.4e-14 Identity = 46/95 (48.42%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of Cp4.1LG05g06760 vs. NCBI nr
Match: gi|657944773|ref|XP_008376426.1| (PREDICTED: protein TPX2 [Malus domestica]) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 50/97 (51.55%), Postives = 62/97 (63.92%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|