Cp4.1LG03g18230 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACATCAACCAGCTACCGGTGGAGTGTATTTCTTCCATTCTGGCCTTCTCCTCGCCGAAGGACGCCTGTAGATCCGCCACCGTCTCGCCGGCTTTCAGATCCGCCGCCGATTCCGAAGCTCTGTGGACCACTTTTCTGCCGTCCGATTACCGGCAGATTATTTCTCAGGCTTCGTCCCCATCTACCACGTCGTTTCTGAATTCCTTGTCCAAAAAGGCTCTCTACTTCCATCTCTGCGATCGTCAGCTTCTCATCGGCTCTGGAAGGAGGTCGATGACTTTACAATGGAGAGTGGGCTGA ATGGACATCAACCAGCTACCGGTGGAGTGTATTTCTTCCATTCTGGCCTTCTCCTCGCCGAAGGACGCCTGTAGATCCGCCACCGTCTCGCCGGCTTTCAGATCCGCCGCCGATTCCGAAGCTCTGTGGACCACTTTTCTGCCGTCCGATTACCGGCAGATTATTTCTCAGGCTTCGTCCCCATCTACCACGTCGTTTCTGAATTCCTTGTCCAAAAAGGCTCTCTACTTCCATCTCTGCGATCGTCAGCTTCTCATCGGCTCTGGAAGGAGGTCGATGACTTTACAATGGAGAGTGGGCTGA ATGGACATCAACCAGCTACCGGTGGAGTGTATTTCTTCCATTCTGGCCTTCTCCTCGCCGAAGGACGCCTGTAGATCCGCCACCGTCTCGCCGGCTTTCAGATCCGCCGCCGATTCCGAAGCTCTGTGGACCACTTTTCTGCCGTCCGATTACCGGCAGATTATTTCTCAGGCTTCGTCCCCATCTACCACGTCGTTTCTGAATTCCTTGTCCAAAAAGGCTCTCTACTTCCATCTCTGCGATCGTCAGCTTCTCATCGGCTCTGGAAGGAGGTCGATGACTTTACAATGGAGAGTGGGCTGA MDINQLPVECISSILAFSSPKDACRSATVSPAFRSAADSEALWTTFLPSDYRQIISQASSPSTTSFLNSLSKKALYFHLCDRQLLIGSGRRSMTLQWRVG
BLAST of Cp4.1LG03g18230 vs. Swiss-Prot
Match: PP2B8_ARATH (Putative F-box protein PP2-B8 OS=Arabidopsis thaliana GN=PP2B8 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.0e-15 Identity = 40/95 (42.11%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. Swiss-Prot
Match: P2B12_ARATH (Putative F-box protein PP2-B12 OS=Arabidopsis thaliana GN=PP2B12 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.4e-14 Identity = 43/100 (43.00%), Postives = 57/100 (57.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. Swiss-Prot
Match: PP2B2_ARATH (Putative F-box protein PP2-B2 OS=Arabidopsis thaliana GN=PP2B2 PE=3 SV=2) HSP 1 Score: 78.2 bits (191), Expect = 5.8e-14 Identity = 40/93 (43.01%), Postives = 61/93 (65.59%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. Swiss-Prot
Match: SKIP3_ARATH (F-box protein SKIP3 OS=Arabidopsis thaliana GN=SKIP3 PE=1 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 2.9e-13 Identity = 41/94 (43.62%), Postives = 59/94 (62.77%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. Swiss-Prot
Match: FB95_ARATH (F-box protein At2g02240 OS=Arabidopsis thaliana GN=At2g02240 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.3e-13 Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TrEMBL
Match: A0A0A0L445_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G132520 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.7e-33 Identity = 78/100 (78.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TrEMBL
Match: A0A0A0L9G5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G132530 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 6.6e-33 Identity = 76/96 (79.17%), Postives = 81/96 (84.38%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TrEMBL
Match: A0A0A0L6T0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G132020 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.1e-32 Identity = 77/100 (77.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TrEMBL
Match: W9SQH9_9ROSA (F-box protein OS=Morus notabilis GN=L484_007384 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 4.4e-21 Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TrEMBL
Match: V4SAA8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10006729mg PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.4e-20 Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TAIR10
Match: AT2G02340.1 (AT2G02340.1 phloem protein 2-B8) HSP 1 Score: 82.4 bits (202), Expect = 1.7e-16 Identity = 40/95 (42.11%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TAIR10
Match: AT5G24560.1 (AT5G24560.1 phloem protein 2-B12) HSP 1 Score: 78.6 bits (192), Expect = 2.5e-15 Identity = 43/100 (43.00%), Postives = 57/100 (57.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TAIR10
Match: AT2G02250.1 (AT2G02250.1 phloem protein 2-B2) HSP 1 Score: 78.2 bits (191), Expect = 3.2e-15 Identity = 40/93 (43.01%), Postives = 61/93 (65.59%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TAIR10
Match: AT2G02240.1 (AT2G02240.1 F-box family protein) HSP 1 Score: 74.3 bits (181), Expect = 4.7e-14 Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. TAIR10
Match: AT2G02320.1 (AT2G02320.1 phloem protein 2-B7) HSP 1 Score: 73.6 bits (179), Expect = 8.0e-14 Identity = 37/100 (37.00%), Postives = 58/100 (58.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. NCBI nr
Match: gi|778677900|ref|XP_004134378.2| (PREDICTED: putative F-box protein PP2-B12 [Cucumis sativus]) HSP 1 Score: 149.8 bits (377), Expect = 2.5e-33 Identity = 78/100 (78.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. NCBI nr
Match: gi|778677897|ref|XP_011650883.1| (PREDICTED: putative F-box protein PP2-B12 [Cucumis sativus]) HSP 1 Score: 147.9 bits (372), Expect = 9.4e-33 Identity = 76/96 (79.17%), Postives = 81/96 (84.38%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. NCBI nr
Match: gi|778677903|ref|XP_004134006.2| (PREDICTED: putative F-box protein PP2-B12 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.6e-32 Identity = 77/100 (77.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. NCBI nr
Match: gi|659075871|ref|XP_008438376.1| (PREDICTED: putative F-box protein PP2-B12 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 4.7e-32 Identity = 75/100 (75.00%), Postives = 81/100 (81.00%), Query Frame = 1
BLAST of Cp4.1LG03g18230 vs. NCBI nr
Match: gi|720025845|ref|XP_010264074.1| (PREDICTED: putative F-box protein PP2-B12 [Nelumbo nucifera]) HSP 1 Score: 110.2 bits (274), Expect = 2.2e-21 Identity = 55/95 (57.89%), Postives = 71/95 (74.74%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |