Cp4.1LG03g15310 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATTCATCTTTGTTTTCAACAACAATGAAGAAAAGGCTTTGCCTTTTGGTGGCAGTGATGGCGATGGTGGCGCTCCTCACTGGAGCAGGAGCGGCAGAGGCGGTGAATTGCGATCCGATGGAGATGAGAGCATGTCTTCCTGCAATCAAATCCTCAGAGCCGCCGACAGCGGAATGCTGTGATAAAGTGAAGAAGCAAGAGGGATGCCTTTGTGAATACCTGAAAAGCCCAATATTGAAGCCTTATTTAGAGTCTCCCAATGCTAAAAAGATAGCTTCTTCCTGTGGCATTCCCATCCCCACCTGCTAG ATGTATTCATCTTTGTTTTCAACAACAATGAAGAAAAGGCTTTGCCTTTTGGTGGCAGTGATGGCGATGGTGGCGCTCCTCACTGGAGCAGGAGCGGCAGAGGCGGTGAATTGCGATCCGATGGAGATGAGAGCATGTCTTCCTGCAATCAAATCCTCAGAGCCGCCGACAGCGGAATGCTGTGATAAAGTGAAGAAGCAAGAGGGATGCCTTTGTGAATACCTGAAAAGCCCAATATTGAAGCCTTATTTAGAGTCTCCCAATGCTAAAAAGATAGCTTCTTCCTGTGGCATTCCCATCCCCACCTGCTAG ATGTATTCATCTTTGTTTTCAACAACAATGAAGAAAAGGCTTTGCCTTTTGGTGGCAGTGATGGCGATGGTGGCGCTCCTCACTGGAGCAGGAGCGGCAGAGGCGGTGAATTGCGATCCGATGGAGATGAGAGCATGTCTTCCTGCAATCAAATCCTCAGAGCCGCCGACAGCGGAATGCTGTGATAAAGTGAAGAAGCAAGAGGGATGCCTTTGTGAATACCTGAAAAGCCCAATATTGAAGCCTTATTTAGAGTCTCCCAATGCTAAAAAGATAGCTTCTTCCTGTGGCATTCCCATCCCCACCTGCTAG MYSSLFSTTMKKRLCLLVAVMAMVALLTGAGAAEAVNCDPMEMRACLPAIKSSEPPTAECCDKVKKQEGCLCEYLKSPILKPYLESPNAKKIASSCGIPIPTC
BLAST of Cp4.1LG03g15310 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.0e-18 Identity = 43/95 (45.26%), Postives = 62/95 (65.26%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-16 Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-14 Identity = 35/94 (37.23%), Postives = 54/94 (57.45%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. Swiss-Prot
Match: NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP-2 PE=3 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 2.7e-14 Identity = 40/95 (42.11%), Postives = 55/95 (57.89%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. Swiss-Prot
Match: NLTPX_ORYSJ (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica GN=LTP-2 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.7e-14 Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TrEMBL
Match: A0A0A0KW09_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G141230 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.7e-31 Identity = 69/93 (74.19%), Postives = 80/93 (86.02%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TrEMBL
Match: B9H330_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s09510g PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.6e-20 Identity = 46/92 (50.00%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TrEMBL
Match: I1N5L5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_19G002300 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.6e-20 Identity = 48/95 (50.53%), Postives = 67/95 (70.53%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TrEMBL
Match: A0A0B2QIV0_GLYSO (Putative non-specific lipid-transfer protein AKCS9 OS=Glycine soja GN=glysoja_037194 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.6e-20 Identity = 48/95 (50.53%), Postives = 67/95 (70.53%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TrEMBL
Match: A0A0B2R6M8_GLYSO (Non-specific lipid-transfer protein 2 OS=Glycine soja GN=glysoja_022186 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-19 Identity = 49/95 (51.58%), Postives = 64/95 (67.37%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TAIR10
Match: AT3G18280.1 (AT3G18280.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 91.3 bits (225), Expect = 3.8e-19 Identity = 43/94 (45.74%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TAIR10
Match: AT1G48750.1 (AT1G48750.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 90.1 bits (222), Expect = 8.5e-19 Identity = 40/94 (42.55%), Postives = 62/94 (65.96%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TAIR10
Match: AT1G07747.1 (AT1G07747.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 1.1e-15 Identity = 36/94 (38.30%), Postives = 58/94 (61.70%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TAIR10
Match: AT5G38160.1 (AT5G38160.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 77.4 bits (189), Expect = 5.7e-15 Identity = 31/88 (35.23%), Postives = 54/88 (61.36%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 75.1 bits (183), Expect = 2.8e-14 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. NCBI nr
Match: gi|700198657|gb|KGN53815.1| (hypothetical protein Csa_4G141230 [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 2.4e-31 Identity = 69/93 (74.19%), Postives = 80/93 (86.02%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. NCBI nr
Match: gi|659086709|ref|XP_008444077.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 5.9e-30 Identity = 68/98 (69.39%), Postives = 81/98 (82.65%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. NCBI nr
Match: gi|694439405|ref|XP_009346593.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus x bretschneideri]) HSP 1 Score: 112.8 bits (281), Expect = 3.5e-22 Identity = 49/89 (55.06%), Postives = 69/89 (77.53%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. NCBI nr
Match: gi|658053478|ref|XP_008362493.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Malus domestica]) HSP 1 Score: 108.6 bits (270), Expect = 6.5e-21 Identity = 49/89 (55.06%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of Cp4.1LG03g15310 vs. NCBI nr
Match: gi|224079367|ref|XP_002305838.1| (hypothetical protein POPTR_0004s09510g [Populus trichocarpa]) HSP 1 Score: 104.8 bits (260), Expect = 9.4e-20 Identity = 46/92 (50.00%), Postives = 66/92 (71.74%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|