Cp4.1LG03g13160 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATGAAGAACATCGCCTGCGCTGCCCTCTTCGCCGCCGCTGCAGTCACTGCAGTTGTGGCCTCCGATGAGTCTCTCTCTCCCGCTGCCGCTCCTGGGCCGAGCAGCGCCGCCTCCGCCGCTCTTCCCGCCCTTGGATCGCTTATCGGTGCGTCGCTTGTTTCCTTCGTCGCCTACGTATTGAACTGA ATGGAAATGAAGAACATCGCCTGCGCTGCCCTCTTCGCCGCCGCTGCAGTCACTGCAGTTGTGGCCTCCGATGAGTCTCTCTCTCCCGCTGCCGCTCCTGGGCCGAGCAGCGCCGCCTCCGCCGCTCTTCCCGCCCTTGGATCGCTTATCGGTGCGTCGCTTGTTTCCTTCGTCGCCTACGTATTGAACTGA ATGGAAATGAAGAACATCGCCTGCGCTGCCCTCTTCGCCGCCGCTGCAGTCACTGCAGTTGTGGCCTCCGATGAGTCTCTCTCTCCCGCTGCCGCTCCTGGGCCGAGCAGCGCCGCCTCCGCCGCTCTTCCCGCCCTTGGATCGCTTATCGGTGCGTCGCTTGTTTCCTTCGTCGCCTACGTATTGAACTGA MEMKNIACAALFAAAAVTAVVASDESLSPAAAPGPSSAASAALPALGSLIGASLVSFVAYVLN
BLAST of Cp4.1LG03g13160 vs. Swiss-Prot
Match: AGP23_ARATH (Arabinogalactan peptide 23 OS=Arabidopsis thaliana GN=AGP23 PE=2 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 4.9e-11 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TrEMBL
Match: A0A0A0L9U8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G697910 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.8e-10 Identity = 44/62 (70.97%), Postives = 51/62 (82.26%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TrEMBL
Match: A0A0A0K6L5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G428800 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.9e-09 Identity = 51/68 (75.00%), Postives = 55/68 (80.88%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TrEMBL
Match: A0A078CAG3_BRANA (BnaC08g28710D protein OS=Brassica napus GN=BnaC08g28710D PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.1e-09 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TrEMBL
Match: A0A0D3DU11_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.1e-09 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TrEMBL
Match: A0A0D3CUE4_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-08 Identity = 42/63 (66.67%), Postives = 52/63 (82.54%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TAIR10
Match: AT3G57690.1 (AT3G57690.1 arabinogalactan protein 23) HSP 1 Score: 67.8 bits (164), Expect = 2.8e-12 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. TAIR10
Match: AT2G41905.1 (AT2G41905.1 BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1)) HSP 1 Score: 57.4 bits (137), Expect = 3.7e-09 Identity = 40/64 (62.50%), Postives = 49/64 (76.56%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. NCBI nr
Match: gi|659122692|ref|XP_008461276.1| (PREDICTED: arabinogalactan peptide 23-like [Cucumis melo]) HSP 1 Score: 74.7 bits (182), Expect = 6.4e-11 Identity = 51/64 (79.69%), Postives = 55/64 (85.94%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. NCBI nr
Match: gi|700203465|gb|KGN58598.1| (hypothetical protein Csa_3G697910 [Cucumis sativus]) HSP 1 Score: 71.6 bits (174), Expect = 5.4e-10 Identity = 44/62 (70.97%), Postives = 51/62 (82.26%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. NCBI nr
Match: gi|700189910|gb|KGN45143.1| (hypothetical protein Csa_7G428800 [Cucumis sativus]) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-09 Identity = 51/68 (75.00%), Postives = 55/68 (80.88%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. NCBI nr
Match: gi|15230372|ref|NP_191328.1| (arabinogalactan protein 23 [Arabidopsis thaliana]) HSP 1 Score: 67.8 bits (164), Expect = 7.8e-09 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of Cp4.1LG03g13160 vs. NCBI nr
Match: gi|674961597|emb|CDX72003.1| (BnaC08g28710D [Brassica napus]) HSP 1 Score: 67.4 bits (163), Expect = 1.0e-08 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |