Cp4.1LG02g04510 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATACGCCTCGTCGAAAACTCCCAAGCCGGCGCCGGCACCGGCACCGGCACCGGCGCGGACTACTCCTCCTCCGGCAGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGAGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATACGCCTCGTCGAAAACTCCCAAGCCGGCGCCGGCACCGGCACCGGCACCGGCGCGGACTACTCCTCCTCCGGCAGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGAGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATACGCCTCGTCGAAAACTCCCAAGCCGGCGCCGGCACCGGCACCGGCACCGGCGCGGACTACTCCTCCTCCGGCAGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGAGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA MSGVWVFRSNGVIRLVENSQAGAGTGTGTGADYSSSGSGGGRKKVLVHLPSGQPVCSYGFLEKILEGLGWERYYEGDPDLFQFHKLSSIDLISLPMEFSKFNSVYMYDLVVKNPNVFHVREP
BLAST of Cp4.1LG02g04510 vs. Swiss-Prot
Match: FLP1_ARATH (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana GN=FLP1 PE=2 SV=2) HSP 1 Score: 150.6 bits (379), Expect = 1.1e-35 Identity = 80/128 (62.50%), Postives = 91/128 (71.09%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. Swiss-Prot
Match: FLP2_ARATH (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana GN=FLP2 PE=2 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.2e-35 Identity = 76/121 (62.81%), Postives = 87/121 (71.90%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. Swiss-Prot
Match: FPF1_ARATH (Flowering-promoting factor 1 OS=Arabidopsis thaliana GN=FPF1 PE=2 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 5.2e-33 Identity = 76/123 (61.79%), Postives = 92/123 (74.80%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. Swiss-Prot
Match: FPF1_SINAL (Flowering-promoting factor 1 OS=Sinapis alba GN=FPF1 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.6e-32 Identity = 73/122 (59.84%), Postives = 87/122 (71.31%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. Swiss-Prot
Match: FLP1_ORYSJ (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica GN=RAA1 PE=1 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.8e-30 Identity = 73/119 (61.34%), Postives = 82/119 (68.91%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TrEMBL
Match: A0A0A0LHE6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G881700 PE=4 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 2.9e-51 Identity = 101/123 (82.11%), Postives = 109/123 (88.62%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TrEMBL
Match: A0A067FUZ2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g033867mg PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.2e-39 Identity = 84/121 (69.42%), Postives = 94/121 (77.69%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TrEMBL
Match: A0A068TXC9_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00034354001 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 3.4e-39 Identity = 83/121 (68.60%), Postives = 93/121 (76.86%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TrEMBL
Match: B9NA04_POPTR (FLOWERING PROMOTING FACTOR 1 family protein OS=Populus trichocarpa GN=POPTR_0018s03780g PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 3.4e-39 Identity = 83/121 (68.60%), Postives = 95/121 (78.51%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TrEMBL
Match: V4UBH3_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10009959mg PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 4.4e-39 Identity = 83/120 (69.17%), Postives = 93/120 (77.50%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TAIR10
Match: AT4G31380.1 (AT4G31380.1 FPF1-like protein 1) HSP 1 Score: 150.6 bits (379), Expect = 6.3e-37 Identity = 80/128 (62.50%), Postives = 91/128 (71.09%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TAIR10
Match: AT5G10625.1 (AT5G10625.1 BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1)) HSP 1 Score: 147.9 bits (372), Expect = 4.1e-36 Identity = 76/121 (62.81%), Postives = 87/121 (71.90%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. TAIR10
Match: AT5G24860.1 (AT5G24860.1 flowering promoting factor 1) HSP 1 Score: 141.7 bits (356), Expect = 2.9e-34 Identity = 76/123 (61.79%), Postives = 92/123 (74.80%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. NCBI nr
Match: gi|449437076|ref|XP_004136318.1| (PREDICTED: flowering-promoting factor 1-like protein 2 [Cucumis sativus]) HSP 1 Score: 209.1 bits (531), Expect = 4.2e-51 Identity = 101/123 (82.11%), Postives = 109/123 (88.62%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. NCBI nr
Match: gi|659132678|ref|XP_008466327.1| (PREDICTED: flowering-promoting factor 1-like protein 2 [Cucumis melo]) HSP 1 Score: 206.8 bits (525), Expect = 2.1e-50 Identity = 105/137 (76.64%), Postives = 109/137 (79.56%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. NCBI nr
Match: gi|568860160|ref|XP_006483594.1| (PREDICTED: flowering-promoting factor 1-like protein 2 [Citrus sinensis]) HSP 1 Score: 170.6 bits (431), Expect = 1.7e-39 Identity = 84/121 (69.42%), Postives = 94/121 (77.69%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. NCBI nr
Match: gi|694372573|ref|XP_009363602.1| (PREDICTED: flowering-promoting factor 1-like [Pyrus x bretschneideri]) HSP 1 Score: 170.6 bits (431), Expect = 1.7e-39 Identity = 84/121 (69.42%), Postives = 93/121 (76.86%), Query Frame = 1
BLAST of Cp4.1LG02g04510 vs. NCBI nr
Match: gi|743903357|ref|XP_011045026.1| (PREDICTED: flowering-promoting factor 1-like [Populus euphratica]) HSP 1 Score: 169.5 bits (428), Expect = 3.7e-39 Identity = 84/121 (69.42%), Postives = 94/121 (77.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |