Cp4.1LG01g24940 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGGTCGTTGGAAACCTCTTCCAGGTCGCCCGCACCGGCAAGCATTTCTTCGAATACATCGAAGACTTTCGCCTGATTTATGGCCCAATCTTCACTCTCCAGTTGGGCTCTCGCACCATGATCATCTTGTCCGGCGCCGACCTCATCCATGAAGCCCTAATCAAGCGCGGCCCTGCCTTCGCCAGCCGTCCTGCTGAGAATCCAACCCGAATCGTCTTCAGCTGCAACAAATTCTCTGTCAATGCCGCCGTCTACGGCTCCCTCTGGCGCTCCCTCCGCCGAAACATGGTCGAGAACATGCTCTCTTCCAGCAGCTTGAAGGAATTTCGCGACGTTAGAAAAAACGCCATTGATAATCTCGTTGAACGCATCCGAGCCGACGCCGCCGCCAACGGTGGTGCTGTTTGGGTGTTGAAGAATGCTAGATTCGCTGTGTTCTGTATTCTCTTGGCGATGTGCTTTGGATTAGAAATGGACGAGGAATCGGTTGAGAAAATGGATCAAGTTCTTAAAACCGTTTTGATCACCGTCGATCCGAGAATCGACGATTTTCTCCCGATTTTGAGGCCGTTCTTCTCCAAGCAGAGGAAACGCGCCATGGAAGTGAGAAAAGAGCAAATCGAATTTGTCGTA ATGGCCGCCGACGCCGCCGCCAACGGTGGTGCTGTTTGGGTGTTGAAGAATGCTAGATTCGCTGTGTTCTGTATTCTCTTGGCGATGTGCTTTGGATTAGAAATGGACGAGGAATCGGTTGAGAAAATGGATCAAGTTCTTAAAACCGTTTTGATCACCGTCGATCCGAGAATCGACGATTTTCTCCCGATTTTGAGGCCGTTCTTCTCCAAGCAGAGGAAACGCGCCATGGAAGTGAGAAAAGAGCAAATCGAATTTGTCGTA ATGGCCGCCGACGCCGCCGCCAACGGTGGTGCTGTTTGGGTGTTGAAGAATGCTAGATTCGCTGTGTTCTGTATTCTCTTGGCGATGTGCTTTGGATTAGAAATGGACGAGGAATCGGTTGAGAAAATGGATCAAGTTCTTAAAACCGTTTTGATCACCGTCGATCCGAGAATCGACGATTTTCTCCCGATTTTGAGGCCGTTCTTCTCCAAGCAGAGGAAACGCGCCATGGAAGTGAGAAAAGAGCAAATCGAATTTGTCGTA MAADAAANGGAVWVLKNARFAVFCILLAMCFGLEMDEESVEKMDQVLKTVLITVDPRIDDFLPILRPFFSKQRKRAMEVRKEQIEFVV
BLAST of Cp4.1LG01g24940 vs. Swiss-Prot
Match: C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.1e-32 Identity = 65/85 (76.47%), Postives = 80/85 (94.12%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. Swiss-Prot
Match: C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 1.8e-32 Identity = 63/86 (73.26%), Postives = 79/86 (91.86%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.5e-31 Identity = 63/86 (73.26%), Postives = 79/86 (91.86%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.6e-23 Identity = 59/87 (67.82%), Postives = 68/87 (78.16%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TrEMBL
Match: A0A0A0K9C6_CUCSA (Cytochrome P450 77A3 OS=Cucumis sativus GN=Csa_6G044530 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.3e-37 Identity = 81/85 (95.29%), Postives = 84/85 (98.82%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TrEMBL
Match: A0A061FWP1_THECC (Cytochrome P450 77A3 OS=Theobroma cacao GN=TCM_044134 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.9e-31 Identity = 69/88 (78.41%), Postives = 81/88 (92.05%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TrEMBL
Match: I1LCR6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_10G202400 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.4e-31 Identity = 66/85 (77.65%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TrEMBL
Match: A0A0B2S0A6_GLYSO (Cytochrome P450 77A3 OS=Glycine soja GN=glysoja_016968 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.4e-31 Identity = 66/85 (77.65%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TrEMBL
Match: A0A0D2UWW8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G229800 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 7.1e-31 Identity = 68/88 (77.27%), Postives = 82/88 (93.18%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TAIR10
Match: AT5G04660.1 (AT5G04660.1 cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 139.4 bits (350), Expect = 1.0e-33 Identity = 63/86 (73.26%), Postives = 79/86 (91.86%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TAIR10
Match: AT3G10570.1 (AT3G10570.1 cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 125.9 bits (315), Expect = 1.2e-29 Identity = 58/86 (67.44%), Postives = 74/86 (86.05%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TAIR10
Match: AT5G04630.1 (AT5G04630.1 cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-26 Identity = 51/86 (59.30%), Postives = 71/86 (82.56%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TAIR10
Match: AT3G10560.1 (AT3G10560.1 Cytochrome P450 superfamily protein) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 46/86 (53.49%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. TAIR10
Match: AT1G11600.1 (AT1G11600.1 cytochrome P450, family 77, subfamily B, polypeptide 1) HSP 1 Score: 68.2 bits (165), Expect = 3.0e-12 Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. NCBI nr
Match: gi|659113453|ref|XP_008456581.1| (PREDICTED: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 162.9 bits (411), Expect = 2.5e-37 Identity = 81/85 (95.29%), Postives = 84/85 (98.82%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. NCBI nr
Match: gi|449446271|ref|XP_004140895.1| (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 3.3e-37 Identity = 81/85 (95.29%), Postives = 84/85 (98.82%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. NCBI nr
Match: gi|590566973|ref|XP_007010384.1| (Cytochrome P450 77A3 [Theobroma cacao]) HSP 1 Score: 142.9 bits (359), Expect = 2.7e-31 Identity = 69/88 (78.41%), Postives = 81/88 (92.05%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. NCBI nr
Match: gi|951015570|ref|XP_014510884.1| (PREDICTED: cytochrome P450 77A3 [Vigna radiata var. radiata]) HSP 1 Score: 141.4 bits (355), Expect = 7.8e-31 Identity = 65/87 (74.71%), Postives = 81/87 (93.10%), Query Frame = 1
BLAST of Cp4.1LG01g24940 vs. NCBI nr
Match: gi|571483867|ref|XP_003536307.2| (PREDICTED: cytochrome P450 77A3-like [Glycine max]) HSP 1 Score: 141.4 bits (355), Expect = 7.8e-31 Identity = 66/85 (77.65%), Postives = 81/85 (95.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |