Cp4.1LG01g20880 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAACACATCATGGCATTCATGGTGATGATAATGGAGATTGCCATATTATCAACAGCCTTGGCCATGGTAGCATCTCGAGCCTTACCCGGGTGTGACGAACAGTGTGGCGACGTGCAGATTCCATATCCATTCGGCATCAAAGAAGGGTGCTATCTCAATCAAAATTTCTCGATCACTTGCAACAAAACCGATCGCAATGGACCTTCACGTGTTGCAGCCAGTAGTGCGAACTTGCTATGA ATGAAACACATCATGGCATTCATGGTGATGATAATGGAGATTGCCATATTATCAACAGCCTTGGCCATGGTAGCATCTCGAGCCTTACCCGGGTGTGACGAACAGTGTGGCGACGTGCAGATTCCATATCCATTCGGCATCAAAGAAGGGTGCTATCTCAATCAAAATTTCTCGATCACTTGCAACAAAACCGATCGCAATGGACCTTCACGTGTTGCAGCCAGTAGTGCGAACTTGCTATGA ATGAAACACATCATGGCATTCATGGTGATGATAATGGAGATTGCCATATTATCAACAGCCTTGGCCATGGTAGCATCTCGAGCCTTACCCGGGTGTGACGAACAGTGTGGCGACGTGCAGATTCCATATCCATTCGGCATCAAAGAAGGGTGCTATCTCAATCAAAATTTCTCGATCACTTGCAACAAAACCGATCGCAATGGACCTTCACGTGTTGCAGCCAGTAGTGCGAACTTGCTATGA MKHIMAFMVMIMEIAILSTALAMVASRALPGCDEQCGDVQIPYPFGIKEGCYLNQNFSITCNKTDRNGPSRVAASSANLL
BLAST of Cp4.1LG01g20880 vs. Swiss-Prot
Match: WAKLG_ARATH (Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.4e-07 Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. Swiss-Prot
Match: WAKLH_ARATH (Wall-associated receptor kinase-like 9 OS=Arabidopsis thaliana GN=WAKL9 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.6e-06 Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TrEMBL
Match: A0A0A0KDF0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G351870 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.9e-15 Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TrEMBL
Match: A0A0A0KFE8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G352870 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.8e-10 Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TrEMBL
Match: A0A0A0KCX3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G354370 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.8e-10 Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TrEMBL
Match: A0A0A0KIF3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G350370 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.2e-10 Identity = 35/68 (51.47%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TrEMBL
Match: A0A067EEZ0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g044785mg PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.1e-09 Identity = 29/61 (47.54%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TAIR10
Match: AT1G16260.1 (AT1G16260.1 Wall-associated kinase family protein) HSP 1 Score: 54.7 bits (130), Expect = 3.1e-08 Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TAIR10
Match: AT1G69730.1 (AT1G69730.1 Wall-associated kinase family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.6e-07 Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TAIR10
Match: AT1G21250.1 (AT1G21250.1 cell wall-associated kinase) HSP 1 Score: 48.9 bits (115), Expect = 1.7e-06 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TAIR10
Match: AT1G17910.1 (AT1G17910.1 Wall-associated kinase family protein) HSP 1 Score: 47.8 bits (112), Expect = 3.8e-06 Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. TAIR10
Match: AT1G16110.1 (AT1G16110.1 wall associated kinase-like 6) HSP 1 Score: 47.0 bits (110), Expect = 6.4e-06 Identity = 20/45 (44.44%), Postives = 27/45 (60.00%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. NCBI nr
Match: gi|778722245|ref|XP_011658442.1| (PREDICTED: wall-associated receptor kinase 3-like [Cucumis sativus]) HSP 1 Score: 89.0 bits (219), Expect = 4.2e-15 Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. NCBI nr
Match: gi|659081959|ref|XP_008441597.1| (PREDICTED: wall-associated receptor kinase 2-like [Cucumis melo]) HSP 1 Score: 84.3 bits (207), Expect = 1.0e-13 Identity = 35/49 (71.43%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. NCBI nr
Match: gi|659081963|ref|XP_008441599.1| (PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase 2-like [Cucumis melo]) HSP 1 Score: 72.8 bits (177), Expect = 3.1e-10 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. NCBI nr
Match: gi|778722248|ref|XP_011658443.1| (PREDICTED: wall-associated receptor kinase 2-like [Cucumis sativus]) HSP 1 Score: 71.6 bits (174), Expect = 6.9e-10 Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cp4.1LG01g20880 vs. NCBI nr
Match: gi|700192310|gb|KGN47514.1| (hypothetical protein Csa_6G352870 [Cucumis sativus]) HSP 1 Score: 71.6 bits (174), Expect = 6.9e-10 Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|