Cp4.1LG01g18630 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAAGTATTGGAAGGATGGGAAGAAGGGAACATAAAATTTGGGCCAACTTACAAATATTATCCAAATTCAGAGGCTTATTATGGAGGTGTTCATGGTGTAAAAGCTCAAAAAAGGAGGGCTCCTGCATGGTATTAGCTTCATTTTCTTTCTTCATTTCTTATGGCCTACCCTTTTCTAATTCTTGTCTTAAAATTTAGGTGTGATCGAGTTATATGGAACGGGAAGGGGATTAAGCAAGTATCATATGATCGAGGAGAATCAATGTTGTCAGATCATAGACCTGTAATGGCCATGTTCATGATAGAAGTTGAAACATCGACGAACTTAAAAACTTTGAGGAGTTTCTTTTTATCAAACAGGTTTGAACATCTCAATAATTCTAATACCCCATTTGTTGAGACTGATGAGGATGAAGACGGTGATGAGATATTTTCAACCGTCGGTTTCGTATGTAAAACGAAATTGACTTTTGAAAGTCATCTTTAA ATGGTAAAGTGTGATCGAGTTATATGGAACGGGAAGGGGATTAAGCAAGTATCATATGATCGAGGAGAATCAATGTTGTCAGATCATAGACCTGTAATGGCCATGTTTGAACATCTCAATAATTCTAATACCCCATTTGTTGAGACTGATGAGGATGAAGACGGTGATGAGATATTTTCAACCGTCGGTTTCGTATGTAAAACGAAATTGACTTTTGAAAGTCATCTTTAA ATGGTAAAGTGTGATCGAGTTATATGGAACGGGAAGGGGATTAAGCAAGTATCATATGATCGAGGAGAATCAATGTTGTCAGATCATAGACCTGTAATGGCCATGTTTGAACATCTCAATAATTCTAATACCCCATTTGTTGAGACTGATGAGGATGAAGACGGTGATGAGATATTTTCAACCGTCGGTTTCGTATGTAAAACGAAATTGACTTTTGAAAGTCATCTTTAA MVKCDRVIWNGKGIKQVSYDRGESMLSDHRPVMAMFEHLNNSNTPFVETDEDEDGDEIFSTVGFVCKTKLTFESHL
BLAST of Cp4.1LG01g18630 vs. Swiss-Prot
Match: IP5P5_ARATH (Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.4e-07 Identity = 22/33 (66.67%), Postives = 28/33 (84.85%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. Swiss-Prot
Match: IP5PA_ARATH (Type I inositol polyphosphate 5-phosphatase 10 OS=Arabidopsis thaliana GN=IP5P10 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.0e-07 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. Swiss-Prot
Match: IP5P4_ARATH (Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.0e-07 Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. Swiss-Prot
Match: IP5P7_ARATH (Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.8e-07 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. Swiss-Prot
Match: IP5P9_ARATH (Type IV inositol polyphosphate 5-phosphatase 9 OS=Arabidopsis thaliana GN=IP5P9 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.8e-07 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TrEMBL
Match: A0A061ET90_THECC (Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 OS=Theobroma cacao GN=TCM_022000 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.0e-07 Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TrEMBL
Match: W9S0N6_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_004294 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.0e-07 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TrEMBL
Match: A0A0D2PTK8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G153900 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.0e-07 Identity = 35/74 (47.30%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TrEMBL
Match: K4AS76_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-06 Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TrEMBL
Match: A0A0R0J1K7_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_07G107000 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.8e-06 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TAIR10
Match: AT5G65090.1 (AT5G65090.1 DNAse I-like superfamily protein) HSP 1 Score: 56.6 bits (135), Expect = 7.7e-09 Identity = 22/33 (66.67%), Postives = 28/33 (84.85%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TAIR10
Match: AT3G63240.1 (AT3G63240.1 DNAse I-like superfamily protein) HSP 1 Score: 55.5 bits (132), Expect = 1.7e-08 Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TAIR10
Match: AT5G04980.2 (AT5G04980.2 DNAse I-like superfamily protein) HSP 1 Score: 55.5 bits (132), Expect = 1.7e-08 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TAIR10
Match: AT2G32010.1 (AT2G32010.1 CVP2 like 1) HSP 1 Score: 54.3 bits (129), Expect = 3.8e-08 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. TAIR10
Match: AT2G01900.1 (AT2G01900.1 DNAse I-like superfamily protein) HSP 1 Score: 54.3 bits (129), Expect = 3.8e-08 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. NCBI nr
Match: gi|778698376|ref|XP_004150156.2| (PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 2.6e-19 Identity = 50/97 (51.55%), Postives = 63/97 (64.95%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. NCBI nr
Match: gi|659072729|ref|XP_008466917.1| (PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X1 [Cucumis melo]) HSP 1 Score: 97.4 bits (241), Expect = 1.1e-17 Identity = 54/98 (55.10%), Postives = 63/98 (64.29%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. NCBI nr
Match: gi|659072731|ref|XP_008466924.1| (PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X2 [Cucumis melo]) HSP 1 Score: 97.4 bits (241), Expect = 1.1e-17 Identity = 54/98 (55.10%), Postives = 63/98 (64.29%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. NCBI nr
Match: gi|590629868|ref|XP_007027110.1| (Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 [Theobroma cacao]) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 1
BLAST of Cp4.1LG01g18630 vs. NCBI nr
Match: gi|703131725|ref|XP_010104946.1| (hypothetical protein L484_004294 [Morus notabilis]) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|