Cp4.1LG01g17780 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCACTCAACCGGGCCGTACGGAGAAAACATAGCCGCTGGGTACTACCCTAAGTTCACCGGGGCGGATGTGGTGAAGCTGTGGGTGAACGAGAAGCCGTTGTATGATCATGCGTCGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGAAGCTCGGTCCGGCTTGGATGTGCTAGAGTGCCCTGTAAGGCTAATTCTCAGTTTGTTATTTGCATTTACGATCCTCCTGGCAACTATATTGGGGAAAAGCCTTATGATTCTTGGGTGGTATGA ATGATTCACTCAACCGGGCCGTACGGAGAAAACATAGCCGCTGGGTACTACCCTAAGTTCACCGGGGCGGATGTGGTGAAGCTGTGGGTGAACGAGAAGCCGTTGTATGATCATGCGTCGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGAAGCTCGGTCCGGCTTGGATGTGCTAGAGTGCCCTGTAAGGCTAATTCTCAGTTTGTTATTTGCATTTACGATCCTCCTGGCAACTATATTGGGGAAAAGCCTTATGATTCTTGGGTGGTATGA ATGATTCACTCAACCGGGCCGTACGGAGAAAACATAGCCGCTGGGTACTACCCTAAGTTCACCGGGGCGGATGTGGTGAAGCTGTGGGTGAACGAGAAGCCGTTGTATGATCATGCGTCGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGAAGCTCGGTCCGGCTTGGATGTGCTAGAGTGCCCTGTAAGGCTAATTCTCAGTTTGTTATTTGCATTTACGATCCTCCTGGCAACTATATTGGGGAAAAGCCTTATGATTCTTGGGTGGTATGA MIHSTGPYGENIAAGYYPKFTGADVVKLWVNEKPLYDHASNKCVGGECGHYTQMVWRSSVRLGCARVPCKANSQFVICIYDPPGNYIGEKPYDSWVV
BLAST of Cp4.1LG01g17780 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.0e-31 Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. Swiss-Prot
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.0e-28 Identity = 54/93 (58.06%), Postives = 64/93 (68.82%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. Swiss-Prot
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.2e-27 Identity = 53/93 (56.99%), Postives = 64/93 (68.82%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. Swiss-Prot
Match: PR1A_SOLLC (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.4e-27 Identity = 54/88 (61.36%), Postives = 64/88 (72.73%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. Swiss-Prot
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3) HSP 1 Score: 121.7 bits (304), Expect = 4.4e-27 Identity = 53/93 (56.99%), Postives = 63/93 (67.74%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TrEMBL
Match: A0A0A0KHP4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G483242 PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.7e-41 Identity = 72/94 (76.60%), Postives = 83/94 (88.30%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TrEMBL
Match: A0A0A0LSG5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G381380 PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 8.3e-41 Identity = 72/94 (76.60%), Postives = 82/94 (87.23%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TrEMBL
Match: E2GEV6_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 6.4e-33 Identity = 62/92 (67.39%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TrEMBL
Match: E2GEW0_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 8.3e-33 Identity = 62/92 (67.39%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TrEMBL
Match: E2GEV8_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.9e-32 Identity = 60/92 (65.22%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TAIR10
Match: AT1G50060.1 (AT1G50060.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 124.4 bits (311), Expect = 3.8e-29 Identity = 52/93 (55.91%), Postives = 65/93 (69.89%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TAIR10
Match: AT3G19690.1 (AT3G19690.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 120.9 bits (302), Expect = 4.2e-28 Identity = 50/95 (52.63%), Postives = 67/95 (70.53%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TAIR10
Match: AT2G19990.1 (AT2G19990.1 pathogenesis-related protein-1-like) HSP 1 Score: 119.0 bits (297), Expect = 1.6e-27 Identity = 55/94 (58.51%), Postives = 67/94 (71.28%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TAIR10
Match: AT4G33730.1 (AT4G33730.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 117.1 bits (292), Expect = 6.1e-27 Identity = 49/90 (54.44%), Postives = 59/90 (65.56%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. TAIR10
Match: AT4G25790.1 (AT4G25790.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 117.1 bits (292), Expect = 6.1e-27 Identity = 52/94 (55.32%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. NCBI nr
Match: gi|778722387|ref|XP_011658476.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 72/94 (76.60%), Postives = 83/94 (88.30%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. NCBI nr
Match: gi|700193135|gb|KGN48339.1| (hypothetical protein Csa_6G483242 [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 72/94 (76.60%), Postives = 83/94 (88.30%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. NCBI nr
Match: gi|700207817|gb|KGN62936.1| (hypothetical protein Csa_2G381380 [Cucumis sativus]) HSP 1 Score: 174.1 bits (440), Expect = 1.2e-40 Identity = 72/94 (76.60%), Postives = 82/94 (87.23%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. NCBI nr
Match: gi|778674388|ref|XP_004138862.2| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 1.6e-40 Identity = 72/94 (76.60%), Postives = 82/94 (87.23%), Query Frame = 1
BLAST of Cp4.1LG01g17780 vs. NCBI nr
Match: gi|659109009|ref|XP_008454501.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis melo]) HSP 1 Score: 173.3 bits (438), Expect = 2.0e-40 Identity = 72/94 (76.60%), Postives = 82/94 (87.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |