Cp4.1LG01g17610 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTGGACTCAAACCCTTCCGATCATGGCCGCTTTCATGGCCATTTTCATTTTCCTCCTCACCCTAACCAACGCTCAAAACGCCCCCGGTGACTACCTCGCGCTTCACAACCAAGCTCGAGCCCAGGTTGGCGTCGGCCCCATGCAATGAAGCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT ATGATCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT ATGATCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT MINTVAVYAQAYAEKRKGDCAMIHSTGPYGENIAAGYYPEFTGADAVKLWANEKPLYDHASNKCVGGECGHYTQMVWRSSVWLECATVPCKANSQFV
BLAST of Cp4.1LG01g17610 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 9.8e-27 Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. Swiss-Prot
Match: PR1A_SOLLC (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.7e-24 Identity = 52/94 (55.32%), Postives = 64/94 (68.09%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. Swiss-Prot
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.2e-21 Identity = 47/89 (52.81%), Postives = 58/89 (65.17%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. Swiss-Prot
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-21 Identity = 47/87 (54.02%), Postives = 58/87 (66.67%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. Swiss-Prot
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3) HSP 1 Score: 102.8 bits (255), Expect = 2.1e-21 Identity = 48/94 (51.06%), Postives = 58/94 (61.70%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TrEMBL
Match: A0A0A0KHP4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G483242 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 6.0e-39 Identity = 72/95 (75.79%), Postives = 80/95 (84.21%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TrEMBL
Match: A0A0A0LLX7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G381130 PE=3 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.7e-38 Identity = 72/95 (75.79%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TrEMBL
Match: A0A0A0LSG5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G381380 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 8.6e-38 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TrEMBL
Match: E2GEV7_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.8e-28 Identity = 60/95 (63.16%), Postives = 68/95 (71.58%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TrEMBL
Match: E2GEV9_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.6e-28 Identity = 59/95 (62.11%), Postives = 68/95 (71.58%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TAIR10
Match: AT1G50060.1 (AT1G50060.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-25 Identity = 50/95 (52.63%), Postives = 61/95 (64.21%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TAIR10
Match: AT2G19990.1 (AT2G19990.1 pathogenesis-related protein-1-like) HSP 1 Score: 107.5 bits (267), Expect = 4.8e-24 Identity = 52/95 (54.74%), Postives = 66/95 (69.47%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TAIR10
Match: AT3G19690.1 (AT3G19690.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 102.4 bits (254), Expect = 1.6e-22 Identity = 47/96 (48.96%), Postives = 62/96 (64.58%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TAIR10
Match: AT2G14610.1 (AT2G14610.1 pathogenesis-related gene 1) HSP 1 Score: 102.4 bits (254), Expect = 1.6e-22 Identity = 47/86 (54.65%), Postives = 62/86 (72.09%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. TAIR10
Match: AT5G26130.1 (AT5G26130.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 101.3 bits (251), Expect = 3.5e-22 Identity = 50/93 (53.76%), Postives = 62/93 (66.67%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: gi|778722387|ref|XP_011658476.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 8.6e-39 Identity = 72/95 (75.79%), Postives = 80/95 (84.21%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: gi|700193135|gb|KGN48339.1| (hypothetical protein Csa_6G483242 [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 8.6e-39 Identity = 72/95 (75.79%), Postives = 80/95 (84.21%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: gi|778674388|ref|XP_004138862.2| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 2.5e-38 Identity = 72/95 (75.79%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: gi|700207816|gb|KGN62935.1| (hypothetical protein Csa_2G381130 [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 2.5e-38 Identity = 72/95 (75.79%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: gi|700207817|gb|KGN62936.1| (hypothetical protein Csa_2G381380 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 1.2e-37 Identity = 71/94 (75.53%), Postives = 78/94 (82.98%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |