Cp4.1LG01g17420 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTCCAGGGATCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTGGAGGCTAGGGTTCCAATTCCTTATAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAGTGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAATGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAATTCAAGAAGGGTATTCCTCTCATTCCCAAGACTGCCAATGTATGACGTCATTCCTTAATCAGGTTCGTTTCTCTTGCTCTCTAATCTTCTTAAACGTTATCGATTCTATTGATTTCTTGTTATTTTTACCGTGTCATCGATTTCTCATGATCTTGGTTCGAATGTTCAAAGTTCTATGTTTTCTTTTTCTCCTTTCATATTAGGGCTATGATCTTTCTGAGCTGACACCGGATCGTGGATTGACCCCTATAGCATGA ATGGAAGTCCAGGGATCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTGGAGGCTAGGGTTCCAATTCCTTATAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAGTGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAATGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAATTCAAGAAGGGTATTCCTCTCATTCCCAAGACTGCCAATGGCTATGATCTTTCTGAGCTGACACCGGATCGTGGATTGACCCCTATAGCATGA ATGGAAGTCCAGGGATCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTGGAGGCTAGGGTTCCAATTCCTTATAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAGTGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAATGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAATTCAAGAAGGGTATTCCTCTCATTCCCAAGACTGCCAATGGCTATGATCTTTCTGAGCTGACACCGGATCGTGGATTGACCCCTATAGCATGA MEVQGSSKKMIATQAEMVEARVPIPYRDQCAHLLIPLNKCRQSEFYLPWKCENERHSYEKCEYELVMERMLQMQKIREEEAKFKKGIPLIPKTANGYDLSELTPDRGLTPIA
BLAST of Cp4.1LG01g17420 vs. Swiss-Prot
Match: NDUB7_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Arabidopsis thaliana GN=At2g02050 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.9e-34 Identity = 74/102 (72.55%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. Swiss-Prot
Match: NDUB7_DICDI (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Dictyostelium discoideum GN=ndufb7 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 40/86 (46.51%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. Swiss-Prot
Match: NDUB7_PANTR (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pan troglodytes GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-08 Identity = 32/97 (32.99%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. Swiss-Prot
Match: NDUB7_GORGO (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Gorilla gorilla gorilla GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 60.1 bits (144), Expect = 1.8e-08 Identity = 32/97 (32.99%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. Swiss-Prot
Match: NDUB7_PONPY (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pongo pygmaeus GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 60.1 bits (144), Expect = 1.8e-08 Identity = 32/97 (32.99%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TrEMBL
Match: A0A0A0KMK8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G277970 PE=4 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 1.4e-44 Identity = 91/95 (95.79%), Postives = 93/95 (97.89%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TrEMBL
Match: A0A067EXL1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g034138mg PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.1e-41 Identity = 89/102 (87.25%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TrEMBL
Match: V4UAW1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017277mg PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.1e-41 Identity = 89/102 (87.25%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TrEMBL
Match: A0A067KTF2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04846 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.1e-41 Identity = 88/101 (87.13%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TrEMBL
Match: A0A0D2NDD0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G154900 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.6e-40 Identity = 86/101 (85.15%), Postives = 91/101 (90.10%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. TAIR10
Match: AT2G02050.1 (AT2G02050.1 NADH-ubiquinone oxidoreductase B18 subunit, putative) HSP 1 Score: 146.4 bits (368), Expect = 1.1e-35 Identity = 74/102 (72.55%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. NCBI nr
Match: gi|449445264|ref|XP_004140393.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 186.8 bits (473), Expect = 2.1e-44 Identity = 91/95 (95.79%), Postives = 93/95 (97.89%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. NCBI nr
Match: gi|659120462|ref|XP_008460206.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 181.0 bits (458), Expect = 1.1e-42 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. NCBI nr
Match: gi|802597738|ref|XP_012072408.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 177.2 bits (448), Expect = 1.6e-41 Identity = 88/101 (87.13%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. NCBI nr
Match: gi|567911451|ref|XP_006448039.1| (hypothetical protein CICLE_v10017277mg [Citrus clementina]) HSP 1 Score: 177.2 bits (448), Expect = 1.6e-41 Identity = 89/102 (87.25%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of Cp4.1LG01g17420 vs. NCBI nr
Match: gi|823158129|ref|XP_012478939.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 173.3 bits (438), Expect = 2.4e-40 Identity = 86/101 (85.15%), Postives = 91/101 (90.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|