Cp4.1LG01g15970 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTTACTTGACTCCTTCTGGCTTCCACACTCTGGCCTCAAACTATCTGCACATCACTCACCATCACCGTTTCAAACACATCCAAGACCTTATAACCCAGGTGGAGGTCACGCCGGCGGAAATTGCAGAACAGCTCATGACAAGTGACGACGCTGACGTGGCACTTGAATCTGTCGTTGAATTCGTCAACGACAAGAAGAGGAAGAAGATGGGAAAAGAGTGTGGTTCTGAAGTGATTGAAAAGACAGGACAGATTCCCCAACAGGAACCCAGTGAGAAACAGAGATGCAAAAGAAGGCCAAGGAGACAGGGTCGATGA ATGACTTACTTGACTCCTTCTGGCTTCCACACTCTGGCCTCAAACTATCTGCACATCACTCACCATCACCGTTTCAAACACATCCAAGACCTTATAACCCAGGTGGAGGTCACGCCGGCGGAAATTGCAGAACAGCTCATGACAAGTGACGACGCTGACGTGGCACTTGAATCTGTCGTTGAATTCGTCAACGACAAGAAGAGGAAGAAGATGGGAAAAGAGTGTGGTTCTGAAGTGATTGAAAAGACAGGACAGATTCCCCAACAGGAACCCAGTGAGAAACAGAGATGCAAAAGAAGGCCAAGGAGACAGGGTCGATGA ATGACTTACTTGACTCCTTCTGGCTTCCACACTCTGGCCTCAAACTATCTGCACATCACTCACCATCACCGTTTCAAACACATCCAAGACCTTATAACCCAGGTGGAGGTCACGCCGGCGGAAATTGCAGAACAGCTCATGACAAGTGACGACGCTGACGTGGCACTTGAATCTGTCGTTGAATTCGTCAACGACAAGAAGAGGAAGAAGATGGGAAAAGAGTGTGGTTCTGAAGTGATTGAAAAGACAGGACAGATTCCCCAACAGGAACCCAGTGAGAAACAGAGATGCAAAAGAAGGCCAAGGAGACAGGGTCGATGA MTYLTPSGFHTLASNYLHITHHHRFKHIQDLITQVEVTPAEIAEQLMTSDDADVALESVVEFVNDKKRKKMGKECGSEVIEKTGQIPQQEPSEKQRCKRRPRRQGR
BLAST of Cp4.1LG01g15970 vs. Swiss-Prot
Match: AATPC_ARATH (AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.6e-12 Identity = 36/68 (52.94%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. Swiss-Prot
Match: HSR4_ARATH (Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. Swiss-Prot
Match: AATP2_ARATH (AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.9e-09 Identity = 35/69 (50.72%), Postives = 44/69 (63.77%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. Swiss-Prot
Match: AATP3_ARATH (AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 37/78 (47.44%), Postives = 47/78 (60.26%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. Swiss-Prot
Match: AATP1_ARATH (AAA-ATPase At1g43910 OS=Arabidopsis thaliana GN=At1g43910 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.2e-07 Identity = 37/95 (38.95%), Postives = 54/95 (56.84%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TrEMBL
Match: A0A0A0KTD8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G590040 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.0e-25 Identity = 69/108 (63.89%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TrEMBL
Match: K4BYM4_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.1e-13 Identity = 48/106 (45.28%), Postives = 71/106 (66.98%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TrEMBL
Match: F6HG64_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0010g02880 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.8e-13 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TrEMBL
Match: F6HG63_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0010g02870 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.7e-13 Identity = 48/103 (46.60%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TrEMBL
Match: A0A061E928_THECC (ATP binding protein, putative OS=Theobroma cacao GN=TCM_010794 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.0e-12 Identity = 40/67 (59.70%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TAIR10
Match: AT3G50940.1 (AT3G50940.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 72.8 bits (177), Expect = 1.4e-13 Identity = 36/68 (52.94%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TAIR10
Match: AT3G50930.1 (AT3G50930.1 cytochrome BC1 synthesis) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TAIR10
Match: AT2G18190.1 (AT2G18190.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 3.3e-10 Identity = 35/69 (50.72%), Postives = 44/69 (63.77%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TAIR10
Match: AT2G18193.1 (AT2G18193.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 5.7e-10 Identity = 37/78 (47.44%), Postives = 47/78 (60.26%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. TAIR10
Match: AT4G05380.1 (AT4G05380.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 9.7e-10 Identity = 33/70 (47.14%), Postives = 42/70 (60.00%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. NCBI nr
Match: gi|700196510|gb|KGN51687.1| (hypothetical protein Csa_5G590040 [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 1.0e-24 Identity = 69/108 (63.89%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. NCBI nr
Match: gi|565391690|ref|XP_006361553.1| (PREDICTED: AAA-ATPase At3g50940-like [Solanum tuberosum]) HSP 1 Score: 84.0 bits (206), Expect = 1.8e-13 Identity = 52/109 (47.71%), Postives = 74/109 (67.89%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. NCBI nr
Match: gi|460387043|ref|XP_004239200.1| (PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like [Solanum lycopersicum]) HSP 1 Score: 83.2 bits (204), Expect = 3.0e-13 Identity = 48/106 (45.28%), Postives = 71/106 (66.98%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. NCBI nr
Match: gi|297738388|emb|CBI27589.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 82.8 bits (203), Expect = 4.0e-13 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of Cp4.1LG01g15970 vs. NCBI nr
Match: gi|731376136|ref|XP_010655485.1| (PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like [Vitis vinifera]) HSP 1 Score: 82.8 bits (203), Expect = 4.0e-13 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |