Cp4.1LG01g11910 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATTGGGGGCCGGTTTTTGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGTCTGCTGTTTCAGCTTCCTGGCAACCGCAGGTGCTTGGAGTTCGGCAACTTTCACACCAGTGCTGCTGCTATCATCGTTCATTCAGTTCTCTACTTCGGTCTCATTTGCGTTTTCTTGCTTGCCATCAAGGTTCATCTCTATATTGGTTCCTAA ATGGCTGATTGGGGGCCGGTTTTTGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGTCTGCTGTTTCAGCTTCCTGGCAACCGCAGGTGCTTGGAGTTCGGCAACTTTCACACCAGTGCTGCTGCTATCATCGTTCATTCAGTTCTCTACTTCGGTCTCATTTGCGTTTTCTTGCTTGCCATCAAGGTTCATCTCTATATTGGTTCCTAA ATGGCTGATTGGGGGCCGGTTTTTGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGTCTGCTGTTTCAGCTTCCTGGCAACCGCAGGTGCTTGGAGTTCGGCAACTTTCACACCAGTGCTGCTGCTATCATCGTTCATTCAGTTCTCTACTTCGGTCTCATTTGCGTTTTCTTGCTTGCCATCAAGGTTCATCTCTATATTGGTTCCTAA MADWGPVFVAVILFVLLTPGLLFQLPGNRRCLEFGNFHTSAAAIIVHSVLYFGLICVFLLAIKVHLYIGS
BLAST of Cp4.1LG01g11910 vs. TrEMBL
Match: A0A0A0KAG8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G095300 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 9.6e-31 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TrEMBL
Match: A0A067K3J9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17983 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.9e-25 Identity = 55/69 (79.71%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TrEMBL
Match: A0A061E622_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_008724 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.9e-25 Identity = 56/69 (81.16%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TrEMBL
Match: A0A0D2T1M9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G165700 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.0e-24 Identity = 53/69 (76.81%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TrEMBL
Match: A0A0D2TRC2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G176700 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.0e-24 Identity = 55/69 (79.71%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 110.9 bits (276), Expect = 3.2e-25 Identity = 50/69 (72.46%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 99.4 bits (246), Expect = 9.5e-22 Identity = 45/70 (64.29%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 95.9 bits (237), Expect = 1.1e-20 Identity = 43/69 (62.32%), Postives = 57/69 (82.61%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TAIR10
Match: AT3G27030.1 (AT3G27030.1 unknown protein) HSP 1 Score: 92.4 bits (228), Expect = 1.2e-19 Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. TAIR10
Match: AT3G01940.1 (AT3G01940.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 85.9 bits (211), Expect = 1.1e-17 Identity = 39/67 (58.21%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. NCBI nr
Match: gi|778711887|ref|XP_011656810.1| (PREDICTED: uncharacterized protein LOC101208994 [Cucumis sativus]) HSP 1 Score: 140.2 bits (352), Expect = 1.4e-30 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. NCBI nr
Match: gi|659119791|ref|XP_008459846.1| (PREDICTED: uncharacterized protein LOC103498846 [Cucumis melo]) HSP 1 Score: 139.0 bits (349), Expect = 3.1e-30 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. NCBI nr
Match: gi|802724374|ref|XP_012085706.1| (PREDICTED: uncharacterized protein LOC105644831 [Jatropha curcas]) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 55/69 (79.71%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. NCBI nr
Match: gi|590692078|ref|XP_007043960.1| (Uncharacterized protein TCM_008724 [Theobroma cacao]) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 56/69 (81.16%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Cp4.1LG01g11910 vs. NCBI nr
Match: gi|823251864|ref|XP_012458563.1| (PREDICTED: uncharacterized protein LOC105779354 [Gossypium raimondii]) HSP 1 Score: 120.2 bits (300), Expect = 1.5e-24 Identity = 55/69 (79.71%), Postives = 66/69 (95.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |