Cp4.1LG01g07770 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTAAATGTTTGTCCAAACTTAATCAAAAAGATTAAAGTTCATAACGGCGACTGGAAGGATCATTGTCATGGCTCGATCAAAGTCTGGAATTACGTTGTTGGTATGTATAATCCGCACCAACTACATTCACTCGTTTATTTTCTTTCAATGACTGATCTCGTTCTTGCTCTTGTTGTTGTTATATGATTTTGTAAGATGATAAGGCTGAAGAGTTGAAAGAACGAGTTGAATTCGACGACAAGAATCTTGTGGTGTGTATGATTGGATTAGAAGGAGATGTGTTCGAGCATTACAAAGTCTTCAAAGCAATATTCAAGTTTGTGCCAAAGGGACCCAATCGCAGCGCCGTAATTCTTATCTTGGAATATGAGAAACTTCACGATGGTCCTCCGTACCCTCACAAGTACCATGATGCGATGCATAAGCTGGCTAAGGATATTGAATCTCACCTTAAATAA ATGTCATTAAAGTTCATAACGGCGACTGGAAGGATCATTGTCATGGCTCGATCAAAGTCTGGAATTACGTTGTTGGCTGAAGAGTTGAAAGAACGAGTTGAATTCGACGACAAGAATCTTGTGGTGTGTATGATTGGATTAGAAGGAGATGTGTTCGAGCATTACAAAGTCTTCAAAGCAATATTCAAGTTTGTGCCAAAGGGACCCAATCGCAGCGCCGTAATTCTTATCTTGGAATATGAGAAACTTCACGATGGTCCTCCGTACCCTCACAAGTACCATGATGCGATGCATAAGCTGGCTAAGGATATTGAATCTCACCTTAAATAA ATGTCATTAAAGTTCATAACGGCGACTGGAAGGATCATTGTCATGGCTCGATCAAAGTCTGGAATTACGTTGTTGGCTGAAGAGTTGAAAGAACGAGTTGAATTCGACGACAAGAATCTTGTGGTGTGTATGATTGGATTAGAAGGAGATGTGTTCGAGCATTACAAAGTCTTCAAAGCAATATTCAAGTTTGTGCCAAAGGGACCCAATCGCAGCGCCGTAATTCTTATCTTGGAATATGAGAAACTTCACGATGGTCCTCCGTACCCTCACAAGTACCATGATGCGATGCATAAGCTGGCTAAGGATATTGAATCTCACCTTAAATAA MSLKFITATGRIIVMARSKSGITLLAEELKERVEFDDKNLVVCMIGLEGDVFEHYKVFKAIFKFVPKGPNRSAVILILEYEKLHDGPPYPHKYHDAMHKLAKDIESHLK
BLAST of Cp4.1LG01g07770 vs. Swiss-Prot
Match: ML328_ARATH (MLP-like protein 328 OS=Arabidopsis thaliana GN=MLP328 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 7.2e-10 Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TrEMBL
Match: A0A0A0KLB4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G038750 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.3e-29 Identity = 62/84 (73.81%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TrEMBL
Match: A0A0A0KJB3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G038312 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 2.2e-26 Identity = 60/83 (72.29%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TrEMBL
Match: Q84RN5_MOMCH (Putative major latex protein (Fragment) OS=Momordica charantia GN=mlp PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.7e-24 Identity = 56/83 (67.47%), Postives = 64/83 (77.11%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TrEMBL
Match: A0A0A0KIU4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G037656 PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 6.1e-24 Identity = 54/83 (65.06%), Postives = 64/83 (77.11%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TrEMBL
Match: A0A0A0KML3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G038093 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.9e-23 Identity = 56/84 (66.67%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TAIR10
Match: AT4G14060.1 (AT4G14060.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.8e-11 Identity = 31/82 (37.80%), Postives = 46/82 (56.10%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TAIR10
Match: AT2G01520.1 (AT2G01520.1 MLP-like protein 328) HSP 1 Score: 64.7 bits (156), Expect = 4.0e-11 Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TAIR10
Match: AT3G26460.1 (AT3G26460.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 62.4 bits (150), Expect = 2.0e-10 Identity = 30/82 (36.59%), Postives = 46/82 (56.10%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TAIR10
Match: AT3G26450.1 (AT3G26450.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 3.4e-10 Identity = 29/82 (35.37%), Postives = 45/82 (54.88%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. TAIR10
Match: AT4G23670.1 (AT4G23670.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 3.4e-10 Identity = 30/82 (36.59%), Postives = 46/82 (56.10%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. NCBI nr
Match: gi|449449056|ref|XP_004142281.1| (PREDICTED: MLP-like protein 328 [Cucumis sativus]) HSP 1 Score: 134.8 bits (338), Expect = 9.0e-29 Identity = 62/84 (73.81%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. NCBI nr
Match: gi|659098669|ref|XP_008450250.1| (PREDICTED: MLP-like protein 328 [Cucumis melo]) HSP 1 Score: 132.1 bits (331), Expect = 5.8e-28 Identity = 59/84 (70.24%), Postives = 70/84 (83.33%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. NCBI nr
Match: gi|449449130|ref|XP_004142318.1| (PREDICTED: MLP-like protein 34 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 3.2e-26 Identity = 60/83 (72.29%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. NCBI nr
Match: gi|659098680|ref|XP_008450254.1| (PREDICTED: MLP-like protein 328 [Cucumis melo]) HSP 1 Score: 122.5 bits (306), Expect = 4.6e-25 Identity = 57/84 (67.86%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of Cp4.1LG01g07770 vs. NCBI nr
Match: gi|659098673|ref|XP_008450252.1| (PREDICTED: MLP-like protein 329 isoform X2 [Cucumis melo]) HSP 1 Score: 122.1 bits (305), Expect = 6.0e-25 Identity = 56/84 (66.67%), Postives = 65/84 (77.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|