Cp4.1LG01g07070 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGAAGCTCTCTGCTTTATCACTGGAGAACAACAACTTTACCGGAATGATTCCGGTTATCTACGCGTTCAAAACCGCCGCGCCAAATCCCGGCATCTCGCCGCTCGAGAGGCTGCTGTTGGGCGGAAACTACTTGTTCGGGCCAATCCCAGAGCCCTTGCGGCGGATGAAACCCGACTCCGCCACCGTCCGACTCGGCGGGAACTGTCTATTTCGCTGCCCAACATTCTTCTTCTTCTGTGAAGGCGGCGAACAAAAATCCACCGCCGTGTGCCGGAGCGCCGGCCCGATGATCCCATAA ATGCCGAAGCTCTCTGCTTTATCACTGGAGAACAACAACTTTACCGGAATGATTCCGGTTATCTACGCGTTCAAAACCGCCGCGCCAAATCCCGGCATCTCGCCGCTCGAGAGGCTGCTGTTGGGCGGAAACTACTTGTTCGGGCCAATCCCAGAGCCCTTGCGGCGGATGAAACCCGACTCCGCCACCGTCCGACTCGGCGGGAACTGTCTATTTCGCTGCCCAACATTCTTCTTCTTCTGTGAAGGCGGCGAACAAAAATCCACCGCCGTGTGCCGGAGCGCCGGCCCGATGATCCCATAA ATGCCGAAGCTCTCTGCTTTATCACTGGAGAACAACAACTTTACCGGAATGATTCCGGTTATCTACGCGTTCAAAACCGCCGCGCCAAATCCCGGCATCTCGCCGCTCGAGAGGCTGCTGTTGGGCGGAAACTACTTGTTCGGGCCAATCCCAGAGCCCTTGCGGCGGATGAAACCCGACTCCGCCACCGTCCGACTCGGCGGGAACTGTCTATTTCGCTGCCCAACATTCTTCTTCTTCTGTGAAGGCGGCGAACAAAAATCCACCGCCGTGTGCCGGAGCGCCGGCCCGATGATCCCATAA MPKLSALSLENNNFTGMIPVIYAFKTAAPNPGISPLERLLLGGNYLFGPIPEPLRRMKPDSATVRLGGNCLFRCPTFFFFCEGGEQKSTAVCRSAGPMIP
BLAST of Cp4.1LG01g07070 vs. TrEMBL
Match: A0A0A0KXY8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G043880 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.3e-44 Identity = 84/100 (84.00%), Postives = 88/100 (88.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. TrEMBL
Match: M5VQ43_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa006641mg PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.7e-34 Identity = 69/100 (69.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. TrEMBL
Match: A5AN28_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_04s0023g02840 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.5e-34 Identity = 67/100 (67.00%), Postives = 76/100 (76.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. TrEMBL
Match: W9T0X6_9ROSA (Receptor-like protein 12 OS=Morus notabilis GN=L484_026730 PE=4 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 6.0e-34 Identity = 69/100 (69.00%), Postives = 78/100 (78.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. TrEMBL
Match: B9HFC6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0007s13680g PE=4 SV=2) HSP 1 Score: 144.1 bits (362), Expect = 9.5e-32 Identity = 64/100 (64.00%), Postives = 74/100 (74.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. TAIR10
Match: AT5G66330.1 (AT5G66330.1 Leucine-rich repeat (LRR) family protein) HSP 1 Score: 120.9 bits (302), Expect = 4.4e-28 Identity = 54/99 (54.55%), Postives = 66/99 (66.67%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. NCBI nr
Match: gi|659107518|ref|XP_008453716.1| (PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA [Cucumis melo]) HSP 1 Score: 190.7 bits (483), Expect = 1.3e-45 Identity = 86/100 (86.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. NCBI nr
Match: gi|449457496|ref|XP_004146484.1| (PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 [Cucumis sativus]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 84/100 (84.00%), Postives = 88/100 (88.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. NCBI nr
Match: gi|694406892|ref|XP_009378217.1| (PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2 [Pyrus x bretschneideri]) HSP 1 Score: 163.7 bits (413), Expect = 1.7e-37 Identity = 74/100 (74.00%), Postives = 80/100 (80.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. NCBI nr
Match: gi|694421647|ref|XP_009338658.1| (PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2 [Pyrus x bretschneideri]) HSP 1 Score: 162.9 bits (411), Expect = 2.8e-37 Identity = 74/100 (74.00%), Postives = 80/100 (80.00%), Query Frame = 1
BLAST of Cp4.1LG01g07070 vs. NCBI nr
Match: gi|658021800|ref|XP_008346303.1| (PREDICTED: receptor-like protein 12 [Malus domestica]) HSP 1 Score: 157.9 bits (398), Expect = 9.1e-36 Identity = 72/100 (72.00%), Postives = 78/100 (78.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |