Cp4.1LG00g04140 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATAGCAAAAGTAGCAGCGGTGGTAGCAAAAGCAACAACGGCAGCGCTGGCCAAGCTCATAACTCCACAAGAAGTGGTAGCAATAGCTCTGAGAAGATGGTTGCTCCGGGGAGTGGAGGAGCTGCTCATATCTCTCGAGATGCATTTGAGAGTAATCCTCAGGGTTATTTTGCTAACCTCCATGCAGCTGAAAAGAGTCAAAAGTAG ATGGATAGCAAAAGTAGCAGCGGTGGTAGCAAAAGCAACAACGGCAGCGCTGGCCAAGCTCATAACTCCACAAGAAGTGGTAGCAATAGCTCTGAGAAGATGGTTGCTCCGGGGAGTGGAGGAGCTGCTCATATCTCTCGAGATGCATTTGAGAGTAATCCTCAGGGTTATTTTGCTAACCTCCATGCAGCTGAAAAGAGTCAAAAGTAG ATGGATAGCAAAAGTAGCAGCGGTGGTAGCAAAAGCAACAACGGCAGCGCTGGCCAAGCTCATAACTCCACAAGAAGTGGTAGCAATAGCTCTGAGAAGATGGTTGCTCCGGGGAGTGGAGGAGCTGCTCATATCTCTCGAGATGCATTTGAGAGTAATCCTCAGGGTTATTTTGCTAACCTCCATGCAGCTGAAAAGAGTCAAAAGTAG MDSKSSSGGSKSNNGSAGQAHNSTRSGSNSSEKMVAPGSGGAAHISRDAFESNPQGYFANLHAAEKSQK
BLAST of Cp4.1LG00g04140 vs. TrEMBL
Match: A0A0D2VDF5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G136100 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-06 Identity = 39/67 (58.21%), Postives = 46/67 (68.66%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TrEMBL
Match: A0A0D2VJB7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G135400 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-06 Identity = 39/67 (58.21%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TrEMBL
Match: A0A0D2W5V4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G135800 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.7e-06 Identity = 39/70 (55.71%), Postives = 44/70 (62.86%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TrEMBL
Match: A0A0D2VDF1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G135600 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.7e-06 Identity = 38/67 (56.72%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TrEMBL
Match: A0A0D2SDQ1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G135700 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.7e-06 Identity = 38/67 (56.72%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TAIR10
Match: AT5G61412.1 (AT5G61412.1 unknown protein) HSP 1 Score: 53.1 bits (126), Expect = 7.7e-08 Identity = 32/65 (49.23%), Postives = 43/65 (66.15%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. TAIR10
Match: AT4G33145.1 (AT4G33145.1 unknown protein) HSP 1 Score: 47.4 bits (111), Expect = 4.2e-06 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. NCBI nr
Match: gi|823258227|ref|XP_012461818.1| (PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 [Gossypium raimondii]) HSP 1 Score: 60.1 bits (144), Expect = 1.8e-06 Identity = 39/67 (58.21%), Postives = 46/67 (68.66%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. NCBI nr
Match: gi|823257101|ref|XP_012461185.1| (PREDICTED: loricrin-like [Gossypium raimondii]) HSP 1 Score: 59.7 bits (143), Expect = 2.3e-06 Identity = 39/67 (58.21%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. NCBI nr
Match: gi|763814419|gb|KJB81271.1| (hypothetical protein B456_013G135600 [Gossypium raimondii]) HSP 1 Score: 58.2 bits (139), Expect = 6.8e-06 Identity = 38/67 (56.72%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. NCBI nr
Match: gi|763814420|gb|KJB81272.1| (hypothetical protein B456_013G135700 [Gossypium raimondii]) HSP 1 Score: 58.2 bits (139), Expect = 6.8e-06 Identity = 38/67 (56.72%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG00g04140 vs. NCBI nr
Match: gi|763814421|gb|KJB81273.1| (hypothetical protein B456_013G135800 [Gossypium raimondii]) HSP 1 Score: 58.2 bits (139), Expect = 6.8e-06 Identity = 39/70 (55.71%), Postives = 44/70 (62.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|