CmaCh19G007190 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTATACTGCCGGAGATCATTCATCACGCAAGGCAAATAACTCACCGATCAGCGTCGTCGCATCACCGATCGGGTTGTTCGGATGTTCCGAAAGGCCATTTTGTGGTGTATGTTGGGGAGGAAGAAGATGAGAGGAAGCGATTTGTGGTGCCATTGTCGTACTTGAAGAATCCCCTGTTTCAAGAACTGTTGAGCCAAGCTGCTGAAGAGTTTGGATTTGAGCATCAGGTTGGTAGGATTACGATACCTTGTGCGCACGATCATTTTCTGAGTTTAACTTCTGGATTGAACTGA ATGGGTATACTGCCGGAGATCATTCATCACGCAAGGCAAATAACTCACCGATCAGCGTCGTCGCATCACCGATCGGGTTGTTCGGATGTTCCGAAAGGCCATTTTGTGGTGTATGTTGGGGAGGAAGAAGATGAGAGGAAGCGATTTGTGGTGCCATTGTCGTACTTGAAGAATCCCCTGTTTCAAGAACTGTTGAGCCAAGCTGCTGAAGAGTTTGGATTTGAGCATCAGGTTGGTAGGATTACGATACCTTGTGCGCACGATCATTTTCTGAGTTTAACTTCTGGATTGAACTGA ATGGGTATACTGCCGGAGATCATTCATCACGCAAGGCAAATAACTCACCGATCAGCGTCGTCGCATCACCGATCGGGTTGTTCGGATGTTCCGAAAGGCCATTTTGTGGTGTATGTTGGGGAGGAAGAAGATGAGAGGAAGCGATTTGTGGTGCCATTGTCGTACTTGAAGAATCCCCTGTTTCAAGAACTGTTGAGCCAAGCTGCTGAAGAGTTTGGATTTGAGCATCAGGTTGGTAGGATTACGATACCTTGTGCGCACGATCATTTTCTGAGTTTAACTTCTGGATTGAACTGA MGILPEIIHHARQITHRSASSHHRSGCSDVPKGHFVVYVGEEEDERKRFVVPLSYLKNPLFQELLSQAAEEFGFEHQVGRITIPCAHDHFLSLTSGLN
BLAST of CmaCh19G007190 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.8e-18 Identity = 42/80 (52.50%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of CmaCh19G007190 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.1e-17 Identity = 42/74 (56.76%), Postives = 54/74 (72.97%), Query Frame = 1
BLAST of CmaCh19G007190 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 40/70 (57.14%), Postives = 53/70 (75.71%), Query Frame = 1
BLAST of CmaCh19G007190 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.4e-17 Identity = 41/85 (48.24%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of CmaCh19G007190 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.2e-17 Identity = 43/81 (53.09%), Postives = 56/81 (69.14%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TrEMBL
Match: A0A0A0K2G9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009150 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.3e-33 Identity = 79/109 (72.48%), Postives = 88/109 (80.73%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TrEMBL
Match: B9HRC6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s13020g PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-25 Identity = 61/101 (60.40%), Postives = 73/101 (72.28%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TrEMBL
Match: W9QIM9_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_000888 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.2e-25 Identity = 59/96 (61.46%), Postives = 73/96 (76.04%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TrEMBL
Match: A0A067DW04_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g039421mg PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.4e-25 Identity = 60/108 (55.56%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TrEMBL
Match: V4SIE4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10030035mg PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.4e-25 Identity = 60/108 (55.56%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TAIR10
Match: AT4G34770.1 (AT4G34770.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 97.4 bits (241), Expect = 5.1e-21 Identity = 48/87 (55.17%), Postives = 62/87 (71.26%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 94.0 bits (232), Expect = 5.6e-20 Identity = 46/97 (47.42%), Postives = 64/97 (65.98%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TAIR10
Match: AT4G34780.1 (AT4G34780.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 93.6 bits (231), Expect = 7.3e-20 Identity = 44/69 (63.77%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 92.4 bits (228), Expect = 1.6e-19 Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
BLAST of CmaCh19G007190 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 91.3 bits (225), Expect = 3.6e-19 Identity = 48/103 (46.60%), Postives = 68/103 (66.02%), Query Frame = 1
BLAST of CmaCh19G007190 vs. NCBI nr
Match: gi|778730044|ref|XP_004144830.2| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 150.2 bits (378), Expect = 1.9e-33 Identity = 79/109 (72.48%), Postives = 88/109 (80.73%), Query Frame = 1
BLAST of CmaCh19G007190 vs. NCBI nr
Match: gi|659094324|ref|XP_008447999.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 5.4e-33 Identity = 77/109 (70.64%), Postives = 85/109 (77.98%), Query Frame = 1
BLAST of CmaCh19G007190 vs. NCBI nr
Match: gi|1009150935|ref|XP_015893290.1| (PREDICTED: uncharacterized protein LOC107427416 [Ziziphus jujuba]) HSP 1 Score: 123.6 bits (309), Expect = 1.9e-25 Identity = 54/90 (60.00%), Postives = 71/90 (78.89%), Query Frame = 1
BLAST of CmaCh19G007190 vs. NCBI nr
Match: gi|224103265|ref|XP_002312989.1| (hypothetical protein POPTR_0009s13020g [Populus trichocarpa]) HSP 1 Score: 123.2 bits (308), Expect = 2.4e-25 Identity = 61/101 (60.40%), Postives = 73/101 (72.28%), Query Frame = 1
BLAST of CmaCh19G007190 vs. NCBI nr
Match: gi|703062247|ref|XP_010086681.1| (hypothetical protein L484_000888 [Morus notabilis]) HSP 1 Score: 122.9 bits (307), Expect = 3.2e-25 Identity = 59/96 (61.46%), Postives = 73/96 (76.04%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |