CmaCh18G005770 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAGTTTAGAGTGAATGAATACTCTGAGATAGAATGAGAAAAATGGAATTTGATTAGTTCAACTTCTAAAAGTTTGGAACAATTAGAAAATTAGGAAAATGAAACATTTGTTTTGAACACCAAAAAGCCATTAATCAAGTACGACAACAGGTTTTCCAACAAGCCTTACAAGGAGCTCTAGGAACTCTGAATAGTTGTTTGAACAACGAGCTACGTTTACGTACCATCAATGCTAATATTTCCATTTCAAGCAAATGAAATTAGTAATATTATTCGTGAACGTATTGAGCAATATAATAGAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA ATGAAGAACTCCGCGAGGGGGGCCATTGAACAGCTGGAAAAAGTCTGGGCCTGCTTACGAAAAGTCGAAATGGAAGCGGATCAAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTCGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTGCTATAGGCATAGCTCTAAATTGA MKNSARGAIEQLEKVWACLRKVEMEADQEVKIVNTGIVLQVGDDIARIYGLDEVMAGSLVEFEEGAIGIALN
BLAST of CmaCh18G005770 vs. Swiss-Prot
Match: ATPA_OENPA (ATP synthase subunit alpha, chloroplastic OS=Oenothera parviflora GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of CmaCh18G005770 vs. Swiss-Prot
Match: ATPA_OENGL (ATP synthase subunit alpha, chloroplastic OS=Oenothera glazioviana GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of CmaCh18G005770 vs. Swiss-Prot
Match: ATPA_AETGR (ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of CmaCh18G005770 vs. Swiss-Prot
Match: ATPA_POPAL (ATP synthase subunit alpha, chloroplastic OS=Populus alba GN=atpA PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of CmaCh18G005770 vs. Swiss-Prot
Match: ATPA_OENEH (ATP synthase subunit alpha, chloroplastic OS=Oenothera elata subsp. hookeri GN=atpA PE=3 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TrEMBL
Match: A0A0S2IH79_CUCPE (ATP synthase subunit alpha OS=Cucurbita pepo subsp. fraterna GN=atpA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TrEMBL
Match: A0A0S2IEL2_9ROSI (ATP synthase subunit alpha OS=Cucurbita ecuadorensis GN=atpA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TrEMBL
Match: A0A0X8HMW3_9MAGN (ATP synthase subunit alpha, chloroplastic OS=Akebia trifoliata GN=atpA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TrEMBL
Match: A0A0S2IF15_9ROSI (ATP synthase subunit alpha OS=Cucurbita foetidissima GN=atpA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TrEMBL
Match: A0A0S2IHI4_CUCPE (ATP synthase subunit alpha OS=Cucurbita pepo var. texana GN=atpA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. TAIR10
Match: ATCG00120.1 (ATCG00120.1 ATP synthase subunit alpha) HSP 1 Score: 77.0 bits (188), Expect = 5.2e-15 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 1
BLAST of CmaCh18G005770 vs. NCBI nr
Match: gi|1002164216|ref|YP_009234371.1| (ATP synthase CF1 alpha subunit (chloroplast) [Akebia trifoliata]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of CmaCh18G005770 vs. NCBI nr
Match: gi|952954756|gb|ALO22114.1| (AtpA (plastid) [Cucurbita ficifolia]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. NCBI nr
Match: gi|952955021|gb|ALO22375.1| (AtpA (plastid) [Cucurbita moschata]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. NCBI nr
Match: gi|952954380|gb|ALO21744.1| (AtpA (plastid) [Cucurbita argyrosperma]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of CmaCh18G005770 vs. NCBI nr
Match: gi|952954543|gb|ALO21904.1| (AtpA (plastid) [Cucurbita cordata]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 43/62 (69.35%), Postives = 50/62 (80.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |