CmaCh17G005380 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGAAGATAATTGCAGTGTTGTTGGTGTGCATTGTGGTAATGGCTGCATTGCAGGTTTCGAGTGCAACTGAAAGCGTGAAGGAGGCCAAATATGAGGCTAAATTTGAAGCCAAGTATAGGTTATGCTACGAAAAGTGCGAGAAGGAATGTCTTGAGAAGGGCAATGACCAAAGCTTCTGTGAAGTTAAGTGCGATGAAGATTGTGATGAGAAAGAAGTCGCTGGTATACTCTCTTCCTTTTTAAATCATTTTATTCTCATCATTTTTATTTTCTCTTAATAATTAATTAATTGATTTTGTATTTGTATTTGTTTCTAGATAAGCTACACATCAAAGTCAAGAACTGA ATGGCGAAGAAGATAATTGCAGTGTTGTTGGTGTGCATTGTGGTAATGGCTGCATTGCAGGTTTCGAGTGCAACTGAAAGCGTGAAGGAGGCCAAATATGAGGCTAAATTTGAAGCCAAGTATAGGTTATGCTACGAAAAGTGCGAGAAGGAATGTCTTGAGAAGGGCAATGACCAAAGCTTCTGTGAAGTTAAGTGCGATGAAGATTGTGATGAGAAAGAAGTCGCTGATAAGCTACACATCAAAGTCAAGAACTGA ATGGCGAAGAAGATAATTGCAGTGTTGTTGGTGTGCATTGTGGTAATGGCTGCATTGCAGGTTTCGAGTGCAACTGAAAGCGTGAAGGAGGCCAAATATGAGGCTAAATTTGAAGCCAAGTATAGGTTATGCTACGAAAAGTGCGAGAAGGAATGTCTTGAGAAGGGCAATGACCAAAGCTTCTGTGAAGTTAAGTGCGATGAAGATTGTGATGAGAAAGAAGTCGCTGATAAGCTACACATCAAAGTCAAGAACTGA MAKKIIAVLLVCIVVMAALQVSSATESVKEAKYEAKFEAKYRLCYEKCEKECLEKGNDQSFCEVKCDEDCDEKEVADKLHIKVKN
BLAST of CmaCh17G005380 vs. Swiss-Prot
Match: ALL6_OLEEU (Major pollen allergen Ole e 6 OS=Olea europaea GN=OLE6 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.4e-07 Identity = 26/49 (53.06%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of CmaCh17G005380 vs. TrEMBL
Match: A0A0A0KFH6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G102480 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.7e-21 Identity = 56/84 (66.67%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of CmaCh17G005380 vs. TrEMBL
Match: A0A0A0KCI6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G106710 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.9e-21 Identity = 58/84 (69.05%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of CmaCh17G005380 vs. TrEMBL
Match: A0A0A0KPA7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G222980 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.2e-20 Identity = 55/83 (66.27%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of CmaCh17G005380 vs. TrEMBL
Match: A0A0A0K9Z9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G106720 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.0e-19 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh17G005380 vs. TrEMBL
Match: A0A0A0KDP7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G102490 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.3e-18 Identity = 49/81 (60.49%), Postives = 65/81 (80.25%), Query Frame = 1
BLAST of CmaCh17G005380 vs. NCBI nr
Match: gi|659114221|ref|XP_008456958.1| (PREDICTED: major pollen allergen Ole e 6-like [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.2e-22 Identity = 57/83 (68.67%), Postives = 73/83 (87.95%), Query Frame = 1
BLAST of CmaCh17G005380 vs. NCBI nr
Match: gi|700191282|gb|KGN46486.1| (hypothetical protein Csa_6G102480 [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 2.4e-21 Identity = 56/84 (66.67%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of CmaCh17G005380 vs. NCBI nr
Match: gi|700191315|gb|KGN46519.1| (hypothetical protein Csa_6G106710 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 4.1e-21 Identity = 58/84 (69.05%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of CmaCh17G005380 vs. NCBI nr
Match: gi|449457470|ref|XP_004146471.1| (PREDICTED: major pollen allergen Ole e 6-like [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 6.0e-20 Identity = 55/83 (66.27%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of CmaCh17G005380 vs. NCBI nr
Match: gi|700191316|gb|KGN46520.1| (hypothetical protein Csa_6G106720 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 8.6e-19 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|