CmaCh15G001080 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAACAATGAGAAGAAACAAGGAGGAGACAACTTCTTTCAAATGCCACTTCACTATCCCAGATATTCCAAGATGGACTACGAGAACATGCCTGAATGGAAGCTCGACCGCCTTCTCCTCGAGTACGGTCTCCCAACTCATGGCAACTTGCCCTACAAACGACAATTCGCAATGGGTGCTTTCCTCTGGCACGATTTCCACCCTACCTTTAAATTAGATCCCTCCCTTCTCAATAACAAACTTATGTAG ATGGAGAACAATGAGAAGAAACAAGGAGGAGACAACTTCTTTCAAATGCCACTTCACTATCCCAGATATTCCAAGATGGACTACGAGAACATGCCTGAATGGAAGCTCGACCGCCTTCTCCTCGAGTACGGTCTCCCAACTCATGGCAACTTGCCCTACAAACGACAATTCGCAATGGGTGCTTTCCTCTGGCACGATTTCCACCCTACCTTTAAATTAGATCCCTCCCTTCTCAATAACAAACTTATGTAG ATGGAGAACAATGAGAAGAAACAAGGAGGAGACAACTTCTTTCAAATGCCACTTCACTATCCCAGATATTCCAAGATGGACTACGAGAACATGCCTGAATGGAAGCTCGACCGCCTTCTCCTCGAGTACGGTCTCCCAACTCATGGCAACTTGCCCTACAAACGACAATTCGCAATGGGTGCTTTCCTCTGGCACGATTTCCACCCTACCTTTAAATTAGATCCCTCCCTTCTCAATAACAAACTTATGTAG MENNEKKQGGDNFFQMPLHYPRYSKMDYENMPEWKLDRLLLEYGLPTHGNLPYKRQFAMGAFLWHDFHPTFKLDPSLLNNKLM
BLAST of CmaCh15G001080 vs. TrEMBL
Match: W9SNS4_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_010408 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.9e-22 Identity = 51/86 (59.30%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TrEMBL
Match: A0A061FTQ6_THECC (Cytoplasmic tRNA 2-thiolation protein 1 OS=Theobroma cacao GN=TCM_042740 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.7e-21 Identity = 47/63 (74.60%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TrEMBL
Match: B9SE01_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1481450 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.1e-20 Identity = 44/66 (66.67%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TrEMBL
Match: A0A151U034_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_005233 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.3e-20 Identity = 47/64 (73.44%), Postives = 55/64 (85.94%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TrEMBL
Match: K7KAM8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_02G250500 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.0e-20 Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TAIR10
Match: AT3G55570.1 (AT3G55570.1 unknown protein) HSP 1 Score: 94.0 bits (232), Expect = 4.7e-20 Identity = 43/82 (52.44%), Postives = 56/82 (68.29%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TAIR10
Match: AT5G41761.1 (AT5G41761.1 unknown protein) HSP 1 Score: 89.7 bits (221), Expect = 8.9e-19 Identity = 39/62 (62.90%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TAIR10
Match: AT3G11405.1 (AT3G11405.1 unknown protein) HSP 1 Score: 68.2 bits (165), Expect = 2.8e-12 Identity = 33/52 (63.46%), Postives = 39/52 (75.00%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TAIR10
Match: AT3G09950.1 (AT3G09950.1 unknown protein) HSP 1 Score: 67.8 bits (164), Expect = 3.6e-12 Identity = 36/71 (50.70%), Postives = 45/71 (63.38%), Query Frame = 1
BLAST of CmaCh15G001080 vs. TAIR10
Match: AT5G55620.1 (AT5G55620.1 unknown protein) HSP 1 Score: 67.4 bits (163), Expect = 4.7e-12 Identity = 32/61 (52.46%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of CmaCh15G001080 vs. NCBI nr
Match: gi|703144910|ref|XP_010108400.1| (hypothetical protein L484_010408 [Morus notabilis]) HSP 1 Score: 112.8 bits (281), Expect = 2.8e-22 Identity = 51/86 (59.30%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of CmaCh15G001080 vs. NCBI nr
Match: gi|590563159|ref|XP_007009289.1| (Cytoplasmic tRNA 2-thiolation protein 1 [Theobroma cacao]) HSP 1 Score: 108.6 bits (270), Expect = 5.3e-21 Identity = 47/63 (74.60%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of CmaCh15G001080 vs. NCBI nr
Match: gi|223536497|gb|EEF38144.1| (conserved hypothetical protein [Ricinus communis]) HSP 1 Score: 105.1 bits (261), Expect = 5.8e-20 Identity = 44/66 (66.67%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of CmaCh15G001080 vs. NCBI nr
Match: gi|1012361452|gb|KYP72635.1| (hypothetical protein KK1_005233 [Cajanus cajan]) HSP 1 Score: 104.8 bits (260), Expect = 7.6e-20 Identity = 47/64 (73.44%), Postives = 55/64 (85.94%), Query Frame = 1
BLAST of CmaCh15G001080 vs. NCBI nr
Match: gi|947124864|gb|KRH73070.1| (hypothetical protein GLYMA_02G250500 [Glycine max]) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-19 Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |