CmaCh13G003790 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTATCGCAATCGTCGCTCGCGGTGGCAACCCAACGTTTAGATTTGGTGGGTAGCTACAAACCAATAAAAAACATAGATGAGCCCAAGATTCAAAGCTTAGGTGAGTTCGCAGTAAATGAACACAATAAACAGGCAAAAACTCAACTCCACTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTGATAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTTGACGTCCCCAACTAG ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTATCGCAATCGTCGCTCGCGGTGGCAACCCAACGTTTAGATTTGGTGGGTAGCTACAAACCAATAAAAAACATAGATGAGCCCAAGATTCAAAGCTTAGGTGAGTTCGCAGTAAATGAACACAATAAACAGGCAAAAACTCAACTCCACTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTGATAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTTGACGTCCCCAACTAG ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTATCGCAATCGTCGCTCGCGGTGGCAACCCAACGTTTAGATTTGGTGGGTAGCTACAAACCAATAAAAAACATAGATGAGCCCAAGATTCAAAGCTTAGGTGAGTTCGCAGTAAATGAACACAATAAACAGGCAAAAACTCAACTCCACTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTGATAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTTGACGTCCCCAACTAG MAKALFFVASLLLYVLSQSSLAVATQRLDLVGSYKPIKNIDEPKIQSLGEFAVNEHNKQAKTQLHFQKVISGEMQIVAGTNYNLRLTALEGTDSRTYGTLVFTDLNNKNNLINFFDVPN
BLAST of CmaCh13G003790 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.9e-12 Identity = 35/92 (38.04%), Postives = 59/92 (64.13%), Query Frame = 1
BLAST of CmaCh13G003790 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/103 (38.83%), Postives = 65/103 (63.11%), Query Frame = 1
BLAST of CmaCh13G003790 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 9.3e-11 Identity = 27/61 (44.26%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of CmaCh13G003790 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.0e-09 Identity = 39/98 (39.80%), Postives = 56/98 (57.14%), Query Frame = 1
BLAST of CmaCh13G003790 vs. Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.8e-07 Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 4.4e-36 Identity = 83/119 (69.75%), Postives = 100/119 (84.03%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.1e-31 Identity = 77/120 (64.17%), Postives = 98/120 (81.67%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TrEMBL
Match: A0A075F955_TOBAC (Cysteine proteinase inhibitor OS=Nicotiana tabacum GN=CYS9 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.1e-14 Identity = 49/111 (44.14%), Postives = 72/111 (64.86%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.1e-14 Identity = 47/98 (47.96%), Postives = 62/98 (63.27%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.8e-13 Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 70.5 bits (171), Expect = 8.0e-13 Identity = 40/103 (38.83%), Postives = 65/103 (63.11%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 5.2e-12 Identity = 27/61 (44.26%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 56.2 bits (134), Expect = 1.6e-08 Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 54.7 bits (130), Expect = 4.6e-08 Identity = 34/107 (31.78%), Postives = 59/107 (55.14%), Query Frame = 1
BLAST of CmaCh13G003790 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 49.3 bits (116), Expect = 1.9e-06 Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
BLAST of CmaCh13G003790 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 158.7 bits (400), Expect = 6.4e-36 Identity = 83/119 (69.75%), Postives = 100/119 (84.03%), Query Frame = 1
BLAST of CmaCh13G003790 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 1.6e-31 Identity = 77/120 (64.17%), Postives = 98/120 (81.67%), Query Frame = 1
BLAST of CmaCh13G003790 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 84.7 bits (208), Expect = 1.2e-13 Identity = 47/98 (47.96%), Postives = 62/98 (63.27%), Query Frame = 1
BLAST of CmaCh13G003790 vs. NCBI nr
Match: gi|698492842|ref|XP_009792732.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Nicotiana sylvestris]) HSP 1 Score: 84.7 bits (208), Expect = 1.2e-13 Identity = 49/111 (44.14%), Postives = 72/111 (64.86%), Query Frame = 1
BLAST of CmaCh13G003790 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 84.7 bits (208), Expect = 1.2e-13 Identity = 47/98 (47.96%), Postives = 62/98 (63.27%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |