CmaCh13G003730 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGGCTCTTTTCCTTGTGGTTTCTCTTTTCCTCTACGTCCTATCGCTATCGTCGCTCGCAGCGGCAACCCAACGTTTAGATTTGGCTGGCAGCTACAAACCAATAAAAGACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAAACTCAACTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCTGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAATAGTCGAACCTATGGCACTCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCAATGACGTCTCCAAATAG ATGGCTAAGGCTCTTTTCCTTGTGGTTTCTCTTTTCCTCTACGTCCTATCGCTATCGTCGCTCGCAGCGGCAACCCAACGTTTAGATTTGGCTGGCAGCTACAAACCAATAAAAGACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAAACTCAACTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCTGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAATAGTCGAACCTATGGCACTCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCAATGACGTCTCCAAATAG ATGGCTAAGGCTCTTTTCCTTGTGGTTTCTCTTTTCCTCTACGTCCTATCGCTATCGTCGCTCGCAGCGGCAACCCAACGTTTAGATTTGGCTGGCAGCTACAAACCAATAAAAGACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAAACTCAACTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCTGGGACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAATAGTCGAACCTATGGCACTCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCAATGACGTCTCCAAATAG MAKALFLVVSLFLYVLSLSSLAAATQRLDLAGSYKPIKDIDDPKIQSLGEFAVNEHNKQAKTQLQFQKVISGEMQIVAGTNYNLRLTALEGTNSRTYGTLVFTDLNNKNNLINFNDVSK
BLAST of CmaCh13G003730 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.9e-13 Identity = 38/95 (40.00%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of CmaCh13G003730 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-12 Identity = 41/102 (40.20%), Postives = 71/102 (69.61%), Query Frame = 1
BLAST of CmaCh13G003730 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.6e-10 Identity = 40/99 (40.40%), Postives = 58/99 (58.59%), Query Frame = 1
BLAST of CmaCh13G003730 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 6.0e-10 Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 1
BLAST of CmaCh13G003730 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.3e-07 Identity = 35/86 (40.70%), Postives = 48/86 (55.81%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 2.2e-35 Identity = 82/115 (71.30%), Postives = 99/115 (86.09%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.1e-29 Identity = 75/119 (63.03%), Postives = 95/119 (79.83%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.8e-14 Identity = 48/98 (48.98%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-13 Identity = 48/98 (48.98%), Postives = 66/98 (67.35%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TrEMBL
Match: A0A075F955_TOBAC (Cysteine proteinase inhibitor OS=Nicotiana tabacum GN=CYS9 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.4e-13 Identity = 51/114 (44.74%), Postives = 74/114 (64.91%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 71.6 bits (174), Expect = 3.6e-13 Identity = 41/102 (40.20%), Postives = 71/102 (69.61%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 65.1 bits (157), Expect = 3.4e-11 Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 50.4 bits (119), Expect = 8.6e-07 Identity = 32/105 (30.48%), Postives = 58/105 (55.24%), Query Frame = 1
BLAST of CmaCh13G003730 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 48.5 bits (114), Expect = 3.3e-06 Identity = 27/84 (32.14%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of CmaCh13G003730 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 156.4 bits (394), Expect = 3.2e-35 Identity = 82/115 (71.30%), Postives = 99/115 (86.09%), Query Frame = 1
BLAST of CmaCh13G003730 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.5e-29 Identity = 75/119 (63.03%), Postives = 95/119 (79.83%), Query Frame = 1
BLAST of CmaCh13G003730 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 85.5 bits (210), Expect = 6.8e-14 Identity = 48/98 (48.98%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of CmaCh13G003730 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 85.5 bits (210), Expect = 6.8e-14 Identity = 48/98 (48.98%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of CmaCh13G003730 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 84.3 bits (207), Expect = 1.5e-13 Identity = 48/98 (48.98%), Postives = 66/98 (67.35%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |