CmaCh11G017350 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAACAATGAAGCTCTACATCTTTCTCCTCCTCGTCTTTGTCGTCGTCATTCCACTCTCTTTTGCCTTACATGAAACCTCCAACGCTTCATCCCTCGTTGACGATAATTCTGAATACAGCTTCTTTGGCGGAGACTCCTCTGAAGCCATGACTGAAGATAGTCGCCGACAACTTTTCCAATATGGATTCGCTTATAATAAGGAAGCTCGCAAAAGGTATTTGAGTTATTATGCACTTAGGCAGAATAATATCCCTTGTGGCCGTCGTGGTACCTCTTACTATGATTGCAAGAAGCGTAGAACGATCAATCCTTATCGTCGCGGTTGCGCTGCCATCACTGGATGTGCTCGATTCACCGATTAA ATGGGAACAATGAAGCTCTACATCTTTCTCCTCCTCGTCTTTGTCGTCGTCATTCCACTCTCTTTTGCCTTACATGAAACCTCCAACGCTTCATCCCTCGTTGACGATAATTCTGAATACAGCTTCTTTGGCGGAGACTCCTCTGAAGCCATGACTGAAGATAGTCGCCGACAACTTTTCCAATATGGATTCGCTTATAATAAGGAAGCTCGCAAAAGGTATTTGAGTTATTATGCACTTAGGCAGAATAATATCCCTTGTGGCCGTCGTGGTACCTCTTACTATGATTGCAAGAAGCGTAGAACGATCAATCCTTATCGTCGCGGTTGCGCTGCCATCACTGGATGTGCTCGATTCACCGATTAA ATGGGAACAATGAAGCTCTACATCTTTCTCCTCCTCGTCTTTGTCGTCGTCATTCCACTCTCTTTTGCCTTACATGAAACCTCCAACGCTTCATCCCTCGTTGACGATAATTCTGAATACAGCTTCTTTGGCGGAGACTCCTCTGAAGCCATGACTGAAGATAGTCGCCGACAACTTTTCCAATATGGATTCGCTTATAATAAGGAAGCTCGCAAAAGGTATTTGAGTTATTATGCACTTAGGCAGAATAATATCCCTTGTGGCCGTCGTGGTACCTCTTACTATGATTGCAAGAAGCGTAGAACGATCAATCCTTATCGTCGCGGTTGCGCTGCCATCACTGGATGTGCTCGATTCACCGATTAA MGTMKLYIFLLLVFVVVIPLSFALHETSNASSLVDDNSEYSFFGGDSSEAMTEDSRRQLFQYGFAYNKEARKRYLSYYALRQNNIPCGRRGTSYYDCKKRRTINPYRRGCAAITGCARFTD
BLAST of CmaCh11G017350 vs. Swiss-Prot
Match: RLF19_ARATH (Protein RALF-like 19 OS=Arabidopsis thaliana GN=RALFL19 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.8e-15 Identity = 40/69 (57.97%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of CmaCh11G017350 vs. Swiss-Prot
Match: RLF4_ARATH (Protein RALF-like 4 OS=Arabidopsis thaliana GN=RALFL4 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.5e-13 Identity = 50/121 (41.32%), Postives = 68/121 (56.20%), Query Frame = 1
BLAST of CmaCh11G017350 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 40/93 (43.01%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of CmaCh11G017350 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 28/47 (59.57%), Postives = 36/47 (76.60%), Query Frame = 1
BLAST of CmaCh11G017350 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-09 Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TrEMBL
Match: A0A0A0KHU4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G484570 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.5e-23 Identity = 69/121 (57.02%), Postives = 79/121 (65.29%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TrEMBL
Match: A0A0A0KCD7_CUCSA (F3H9.8 protein OS=Cucumis sativus GN=Csa_6G199790 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.0e-20 Identity = 66/121 (54.55%), Postives = 78/121 (64.46%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TrEMBL
Match: R0HVQ3_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10024364mg PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.1e-13 Identity = 40/69 (57.97%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TrEMBL
Match: D7LGD9_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_902453 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 5.4e-13 Identity = 40/69 (57.97%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TrEMBL
Match: M4EMR1_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.2e-12 Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 82.0 bits (201), Expect = 2.7e-16 Identity = 40/69 (57.97%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TAIR10
Match: AT1G28270.1 (AT1G28270.1 ralf-like 4) HSP 1 Score: 75.9 bits (185), Expect = 1.9e-14 Identity = 50/121 (41.32%), Postives = 68/121 (56.20%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 70.9 bits (172), Expect = 6.3e-13 Identity = 40/93 (43.01%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 62.4 bits (150), Expect = 2.2e-10 Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 1
BLAST of CmaCh11G017350 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 61.2 bits (147), Expect = 5.0e-10 Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
BLAST of CmaCh11G017350 vs. NCBI nr
Match: gi|449461879|ref|XP_004148669.1| (PREDICTED: protein RALF-like 19 [Cucumis sativus]) HSP 1 Score: 117.1 bits (292), Expect = 2.2e-23 Identity = 69/121 (57.02%), Postives = 79/121 (65.29%), Query Frame = 1
BLAST of CmaCh11G017350 vs. NCBI nr
Match: gi|659080853|ref|XP_008441015.1| (PREDICTED: protein RALF-like 19 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 1.2e-21 Identity = 66/121 (54.55%), Postives = 77/121 (63.64%), Query Frame = 1
BLAST of CmaCh11G017350 vs. NCBI nr
Match: gi|449466199|ref|XP_004150814.1| (PREDICTED: protein RALF-like 4 [Cucumis sativus]) HSP 1 Score: 106.7 bits (265), Expect = 2.9e-20 Identity = 66/121 (54.55%), Postives = 78/121 (64.46%), Query Frame = 1
BLAST of CmaCh11G017350 vs. NCBI nr
Match: gi|729376459|ref|XP_010549330.1| (PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]) HSP 1 Score: 85.1 bits (209), Expect = 9.1e-14 Identity = 55/125 (44.00%), Postives = 73/125 (58.40%), Query Frame = 1
BLAST of CmaCh11G017350 vs. NCBI nr
Match: gi|1009109354|ref|XP_015889777.1| (PREDICTED: protein RALF-like 19 [Ziziphus jujuba]) HSP 1 Score: 85.1 bits (209), Expect = 9.1e-14 Identity = 46/118 (38.98%), Postives = 69/118 (58.47%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |