CmaCh11G015010 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCATAAGCTTCATCATGGCAGGTCGAGACATGACATTGGCTGCCATGACAGGGCTCTTTTGGCTACTCACCCACCACTCCAATGTTGAGAAACCATTAGTAGAAGAGATAGACCTTGAATCAACTTTGATACTCGAAAAGAAATTTGATTATAAATCTCTCGAGGAGCTCAAATTTCTCAAGGCATGCCTTTGCGAAACCATGAGACTCTATCCGCCAGTCCCAGTCCCATGGGATTCCAAGCATGCCATTGTCAATGACTGGTTGCCCGACGGGACTCCAGTTCAGGCTGGAGACAAAAGTGACATATTTCCCATATGGGATGGGTAG ATGGCCATAAGCTTCATCATGGCAGGTCGAGACATGACATTGGCTGCCATGACAGGGCTCTTTTGGCTACTCACCCACCACTCCAATGTTGAGAAACCATTAGTAGAAGAGATAGACCTTGAATCAACTTTGATACTCGAAAAGAAATTTGATTATAAATCTCTCGAGGAGCTCAAATTTCTCAAGGCATGCCTTTGCGAAACCATGAGACTCTATCCGCCAGTCCCAGTCCCATGGGATTCCAAGCATGCCATTGTCAATGACTGGTTGCCCGACGGGACTCCAGTTCAGGCTGGAGACAAAAGTGACATATTTCCCATATGGGATGGGTAG ATGGCCATAAGCTTCATCATGGCAGGTCGAGACATGACATTGGCTGCCATGACAGGGCTCTTTTGGCTACTCACCCACCACTCCAATGTTGAGAAACCATTAGTAGAAGAGATAGACCTTGAATCAACTTTGATACTCGAAAAGAAATTTGATTATAAATCTCTCGAGGAGCTCAAATTTCTCAAGGCATGCCTTTGCGAAACCATGAGACTCTATCCGCCAGTCCCAGTCCCATGGGATTCCAAGCATGCCATTGTCAATGACTGGTTGCCCGACGGGACTCCAGTTCAGGCTGGAGACAAAAGTGACATATTTCCCATATGGGATGGGTAG MAISFIMAGRDMTLAAMTGLFWLLTHHSNVEKPLVEEIDLESTLILEKKFDYKSLEELKFLKACLCETMRLYPPVPVPWDSKHAIVNDWLPDGTPVQAGDKSDIFPIWDG
BLAST of CmaCh11G015010 vs. Swiss-Prot
Match: C94B3_ARATH (Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.7e-25 Identity = 61/106 (57.55%), Postives = 75/106 (70.75%), Query Frame = 1
BLAST of CmaCh11G015010 vs. Swiss-Prot
Match: C94B1_ARATH (Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.8e-24 Identity = 57/104 (54.81%), Postives = 73/104 (70.19%), Query Frame = 1
BLAST of CmaCh11G015010 vs. Swiss-Prot
Match: C94A2_VICSA (Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.1e-17 Identity = 47/99 (47.47%), Postives = 67/99 (67.68%), Query Frame = 1
BLAST of CmaCh11G015010 vs. Swiss-Prot
Match: C94A1_VICSA (Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 4.4e-15 Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 1
BLAST of CmaCh11G015010 vs. Swiss-Prot
Match: 86A22_PETHY (Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.7e-14 Identity = 44/107 (41.12%), Postives = 70/107 (65.42%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TrEMBL
Match: A0A0A0LBW1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G585890 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 8.8e-31 Identity = 70/106 (66.04%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TrEMBL
Match: B9GJT1_POPTR (Cytochrome P450 family protein OS=Populus trichocarpa GN=POPTR_0001s33860g PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 7.0e-28 Identity = 65/106 (61.32%), Postives = 81/106 (76.42%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TrEMBL
Match: A0A067LD34_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_10127 PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 7.0e-28 Identity = 66/106 (62.26%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TrEMBL
Match: F6H3Y4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0068g02120 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.6e-27 Identity = 67/104 (64.42%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TrEMBL
Match: A0A0D2RQ68_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G041600 PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.9e-27 Identity = 69/107 (64.49%), Postives = 81/107 (75.70%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TAIR10
Match: AT3G01900.1 (AT3G01900.1 cytochrome P450, family 94, subfamily B, polypeptide 2) HSP 1 Score: 117.1 bits (292), Expect = 6.9e-27 Identity = 63/106 (59.43%), Postives = 71/106 (66.98%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TAIR10
Match: AT3G48520.1 (AT3G48520.1 cytochrome P450, family 94, subfamily B, polypeptide 3) HSP 1 Score: 115.2 bits (287), Expect = 2.6e-26 Identity = 61/106 (57.55%), Postives = 75/106 (70.75%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TAIR10
Match: AT5G63450.1 (AT5G63450.1 cytochrome P450, family 94, subfamily B, polypeptide 1) HSP 1 Score: 110.9 bits (276), Expect = 5.0e-25 Identity = 57/104 (54.81%), Postives = 73/104 (70.19%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TAIR10
Match: AT4G00360.1 (AT4G00360.1 cytochrome P450, family 86, subfamily A, polypeptide 2) HSP 1 Score: 79.7 bits (195), Expect = 1.2e-15 Identity = 48/109 (44.04%), Postives = 65/109 (59.63%), Query Frame = 1
BLAST of CmaCh11G015010 vs. TAIR10
Match: AT2G45970.1 (AT2G45970.1 cytochrome P450, family 86, subfamily A, polypeptide 8) HSP 1 Score: 79.3 bits (194), Expect = 1.6e-15 Identity = 47/110 (42.73%), Postives = 67/110 (60.91%), Query Frame = 1
BLAST of CmaCh11G015010 vs. NCBI nr
Match: gi|659098356|ref|XP_008450099.1| (PREDICTED: cytochrome P450 94B3 isoform X2 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 9.7e-31 Identity = 71/106 (66.98%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. NCBI nr
Match: gi|659098354|ref|XP_008450098.1| (PREDICTED: cytochrome P450 94B3 isoform X1 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 9.7e-31 Identity = 71/106 (66.98%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. NCBI nr
Match: gi|778681667|ref|XP_011651558.1| (PREDICTED: cytochrome P450 94B3 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 1.3e-30 Identity = 70/106 (66.04%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. NCBI nr
Match: gi|802539786|ref|XP_012072718.1| (PREDICTED: cytochrome P450 94B3 [Jatropha curcas]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 66/106 (62.26%), Postives = 82/106 (77.36%), Query Frame = 1
BLAST of CmaCh11G015010 vs. NCBI nr
Match: gi|224060245|ref|XP_002300103.1| (cytochrome P450 family protein [Populus trichocarpa]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 65/106 (61.32%), Postives = 81/106 (76.42%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |