CmaCh11G012140 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGATTTTTGCCGAATCCGAGTTTGCTGCTTCAACCATTACCAAACTAATACCTATTCTGTTTAGTACTTCAGGTGCTTCTATTGCGTATAATGTCAATCTTGTAGCGGATCAATTCCAACGAGCCTTTCAAACTAGTACTTTTTGTAATCGACTCTATAGCTTCTTCAATAAACGTTAGTTCTTCAATCAAGTTTTGAATGACTTTCTAGTCAGATCATTCATGCGTTTTGGATATTTAGTCTCATTCGAAGCTTTAGACAAAGGTGCTATTGAGATATTGGGCCTCTATGGTATCTCGTACACATTCCGACGATTGGCCGAGCGAATCAGTCAACTTCAAAGTGGATTTGTT ATGAGATTTTTGCCGAATCCGAGTGCTTCTATTGCGTATAATGTCAATCTTGTAGCGGATCAATTCCAACGAGCCTTTCAAACTAGTACTTTTTGTAATCGACTCTATAGCTTCTTCAATAAACTCAGATCATTCATGCGTTTTGGATATTTAGTCTCATTCGAAGCTTTAGACAAAGGTGCTATTGAGATATTGGGCCTCTATGGTATCTCGTACACATTCCGACGATTGGCCGAGCGAATCAGTCAACTTCAAAGTGGATTTGTT ATGAGATTTTTGCCGAATCCGAGTGCTTCTATTGCGTATAATGTCAATCTTGTAGCGGATCAATTCCAACGAGCCTTTCAAACTAGTACTTTTTGTAATCGACTCTATAGCTTCTTCAATAAACTCAGATCATTCATGCGTTTTGGATATTTAGTCTCATTCGAAGCTTTAGACAAAGGTGCTATTGAGATATTGGGCCTCTATGGTATCTCGTACACATTCCGACGATTGGCCGAGCGAATCAGTCAACTTCAAAGTGGATTTGTT MRFLPNPSASIAYNVNLVADQFQRAFQTSTFCNRLYSFFNKLRSFMRFGYLVSFEALDKGAIEILGLYGISYTFRRLAERISQLQSGFV
BLAST of CmaCh11G012140 vs. Swiss-Prot
Match: NU5M_OENBE (NADH-ubiquinone oxidoreductase chain 5 OS=Oenothera berteroana GN=ND5 PE=2 SV=2) HSP 1 Score: 140.6 bits (353), Expect = 8.4e-33 Identity = 75/93 (80.65%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of CmaCh11G012140 vs. Swiss-Prot
Match: NU5M_MAIZE (NADH-ubiquinone oxidoreductase chain 5 (Fragment) OS=Zea mays GN=ND5 PE=3 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.1e-32 Identity = 75/93 (80.65%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of CmaCh11G012140 vs. Swiss-Prot
Match: NU5M_WHEAT (NADH-ubiquinone oxidoreductase chain 5 OS=Triticum aestivum GN=ND5 PE=3 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.1e-32 Identity = 75/93 (80.65%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of CmaCh11G012140 vs. Swiss-Prot
Match: NU5M_ARATH (NADH-ubiquinone oxidoreductase chain 5 OS=Arabidopsis thaliana GN=ND5 PE=2 SV=3) HSP 1 Score: 138.3 bits (347), Expect = 4.2e-32 Identity = 74/93 (79.57%), Postives = 77/93 (82.80%), Query Frame = 1
BLAST of CmaCh11G012140 vs. Swiss-Prot
Match: NU5M_MARPO (NADH-ubiquinone oxidoreductase chain 5 OS=Marchantia polymorpha GN=ND5 PE=3 SV=2) HSP 1 Score: 100.5 bits (249), Expect = 9.6e-21 Identity = 54/91 (59.34%), Postives = 66/91 (72.53%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TrEMBL
Match: D7RMY6_SILLA (NADH-ubiquinone oxidoreductase chain 5 OS=Silene latifolia GN=nad5 PE=2 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.1e-31 Identity = 77/93 (82.80%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TrEMBL
Match: F4MKW5_BETVM (NADH-ubiquinone oxidoreductase chain 5 OS=Beta vulgaris subsp. maritima GN=nad5 PE=3 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TrEMBL
Match: Q9MF46_BETVU (NADH-ubiquinone oxidoreductase chain 5 OS=Beta vulgaris subsp. vulgaris GN=nad5 PE=2 SV=2) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TrEMBL
Match: E8ZC26_BETVM (NADH-ubiquinone oxidoreductase chain 5 OS=Beta vulgaris subsp. maritima GN=nad5 PE=3 SV=2) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TrEMBL
Match: D5I3G8_CUCPE (NADH-ubiquinone oxidoreductase chain 5 OS=Cucurbita pepo GN=nad5 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.5e-31 Identity = 75/93 (80.65%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TAIR10
Match: ATMG00060.1 (ATMG00060.1 NADH dehydrogenase subunit 5C) HSP 1 Score: 138.3 bits (347), Expect = 2.3e-33 Identity = 74/93 (79.57%), Postives = 77/93 (82.80%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TAIR10
Match: ATMG00513.1 (ATMG00513.1 NADH dehydrogenase 5A) HSP 1 Score: 138.3 bits (347), Expect = 2.3e-33 Identity = 74/93 (79.57%), Postives = 77/93 (82.80%), Query Frame = 1
BLAST of CmaCh11G012140 vs. TAIR10
Match: ATMG00665.1 (ATMG00665.1 NADH dehydrogenase 5B) HSP 1 Score: 138.3 bits (347), Expect = 2.3e-33 Identity = 74/93 (79.57%), Postives = 77/93 (82.80%), Query Frame = 1
BLAST of CmaCh11G012140 vs. NCBI nr
Match: gi|828333979|ref|XP_012575066.1| (PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum]) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 80/101 (79.21%), Postives = 85/101 (84.16%), Query Frame = 1
BLAST of CmaCh11G012140 vs. NCBI nr
Match: gi|307101746|ref|YP_003875478.1| (NADH dehydrogenase subunit 5 (mitochondrion) [Silene latifolia]) HSP 1 Score: 143.7 bits (361), Expect = 1.6e-31 Identity = 77/93 (82.80%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. NCBI nr
Match: gi|384939111|emb|CBL51957.2| (NADH dehydrogenase subunit 5 (mitochondrion) [Beta vulgaris subsp. maritima]) HSP 1 Score: 143.3 bits (360), Expect = 2.1e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. NCBI nr
Match: gi|162279918|ref|NP_064039.2| (nad5 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 143.3 bits (360), Expect = 2.1e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
BLAST of CmaCh11G012140 vs. NCBI nr
Match: gi|345500032|emb|CBX33245.3| (NADH dehydrogenase subunit 5 (mitochondrion) [Beta vulgaris subsp. maritima]) HSP 1 Score: 143.3 bits (360), Expect = 2.1e-31 Identity = 76/93 (81.72%), Postives = 79/93 (84.95%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|