CmaCh11G012070 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTGCTCTAACCGAGATGGAGATGATTCCGTACTACACTCCAATTCGGTGGAGGAACTTTGGGGCTGGGGGGAATGCACCAGGTGTCGTAGCTATCCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGTCGTGATCTTGCTCGTGAGGGTAGGTAATGAAATTATCCGTGAGGCTAGTAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGGAAGGCAATCAAATTCTAA ATGCCTGCTCTAACCGAGATGGAGATGATTCCGTACTACACTCCAATTCGGTGGAGGAACTTTGGGGCTGGGGGGAATGCACCAGGTGTCGTAGCTATCCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGTCGTGATCTTGCTCGTGAGGGTAATGAAATTATCCGTGAGGCTAGTAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGGAAGGCAATCAAATTCTAA ATGCCTGCTCTAACCGAGATGGAGATGATTCCGTACTACACTCCAATTCGGTGGAGGAACTTTGGGGCTGGGGGGAATGCACCAGGTGTCGTAGCTATCCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGTCGTGATCTTGCTCGTGAGGGTAATGAAATTATCCGTGAGGCTAGTAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGGAAGGCAATCAAATTCTAA MPALTEMEMIPYYTPIRWRNFGAGGNAPGVVAIRVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKAIKF
BLAST of CmaCh11G012070 vs. Swiss-Prot
Match: RBL_GOSBA (Ribulose bisphosphate carboxylase large chain OS=Gossypium barbadense GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.8e-25 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. Swiss-Prot
Match: RBL_CAJCA (Ribulose bisphosphate carboxylase large chain OS=Cajanus cajan GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.8e-25 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. Swiss-Prot
Match: RBL_VISAL (Ribulose bisphosphate carboxylase large chain OS=Viscum album GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.8e-25 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. Swiss-Prot
Match: RBL_DRYSU (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Drymophloeus subdistichus GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.8e-25 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. Swiss-Prot
Match: RBL_THEPO (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Thespesia populnea GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.8e-25 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TrEMBL
Match: Q8MDB4_9ARAE (Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) OS=Amorphophallus canaliculatus GN=rbcL PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.8e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TrEMBL
Match: Q8MD74_9ARAE (Ribulose bisphosphate carboxylase large chain OS=Pseudodracontium harmandii GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.4e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TrEMBL
Match: Q8WKF3_9FABA (Ribulose 1,5-bisphosphate carboxylase-oxygenase large subunit (Fragment) OS=Kennedia rubicunda GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.4e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TrEMBL
Match: I6M080_9ROSI (Ribulose bisphosphate carboxylase large chain OS=Gossypium somalense GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.4e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TrEMBL
Match: Q3T5C3_9ROSI (Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) OS=Ditaxis argothamnoides GN=rbcL PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.4e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. TAIR10
Match: ATCG00490.1 (ATCG00490.1 ribulose-bisphosphate carboxylases) HSP 1 Score: 105.1 bits (261), Expect = 2.0e-23 Identity = 59/86 (68.60%), Postives = 61/86 (70.93%), Query Frame = 1
BLAST of CmaCh11G012070 vs. NCBI nr
Match: gi|21667531|gb|AAM74090.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Amorphophallus canaliculatus]) HSP 1 Score: 115.2 bits (287), Expect = 5.4e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. NCBI nr
Match: gi|63259356|gb|AAY40336.1| (ribulose-1,5-biphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Amorphophallus interruptus]) HSP 1 Score: 114.4 bits (285), Expect = 9.3e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. NCBI nr
Match: gi|937637048|gb|ALI92104.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Discophora guianensis]) HSP 1 Score: 114.4 bits (285), Expect = 9.3e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. NCBI nr
Match: gi|449326713|gb|AGE93292.1| (ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Chamaedorea seifrizii]) HSP 1 Score: 114.4 bits (285), Expect = 9.3e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of CmaCh11G012070 vs. NCBI nr
Match: gi|471935|gb|AAA84358.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Luffa quinquefida]) HSP 1 Score: 114.4 bits (285), Expect = 9.3e-23 Identity = 63/86 (73.26%), Postives = 65/86 (75.58%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|