CmaCh10G003170 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTATGGCTAGTGCATTGGATACCTTATGTGGGCAGTCATTCGGCGCAAAGCGATATCATATGCTAGGACTACATACTCAATGTGCAATGTTCGTCCTCTTAGTTGTCAGCATATTTCTTGTCATTATTACATCAAACACCAAAATGATTCTAATTGCATTGCACCAAGATCAGGACATCTCCAAAGGAGCTGGATTATACGCCCGTTACATGATCCCGAGCGTTGTCGCATACGGTTAG ATGGGTATGGCTAGTGCATTGGATACCTTATGTGGGCAGTCATTCGGCGCAAAGCGATATCATATGCTAGGACTACATACTCAATGTGCAATGTTCGTCCTCTTAGTTGTCAGCATATTTCTTGTCATTATTACATCAAACACCAAAATGATTCTAATTGCATTGCACCAAGATCAGGACATCTCCAAAGGAGCTGGATTATACGCCCGTTACATGATCCCGAGCGTTGTCGCATACGGTTAG ATGGGTATGGCTAGTGCATTGGATACCTTATGTGGGCAGTCATTCGGCGCAAAGCGATATCATATGCTAGGACTACATACTCAATGTGCAATGTTCGTCCTCTTAGTTGTCAGCATATTTCTTGTCATTATTACATCAAACACCAAAATGATTCTAATTGCATTGCACCAAGATCAGGACATCTCCAAAGGAGCTGGATTATACGCCCGTTACATGATCCCGAGCGTTGTCGCATACGGTTAG MGMASALDTLCGQSFGAKRYHMLGLHTQCAMFVLLVVSIFLVIITSNTKMILIALHQDQDISKGAGLYARYMIPSVVAYG
BLAST of CmaCh10G003170 vs. Swiss-Prot
Match: DTX17_ARATH (Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-18 Identity = 47/80 (58.75%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of CmaCh10G003170 vs. Swiss-Prot
Match: DTX16_ARATH (Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.8e-17 Identity = 46/80 (57.50%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of CmaCh10G003170 vs. Swiss-Prot
Match: DTX15_ARATH (Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 6.4e-16 Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of CmaCh10G003170 vs. Swiss-Prot
Match: DTX18_ARATH (Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.5e-14 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of CmaCh10G003170 vs. Swiss-Prot
Match: DTX19_ARATH (Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.8e-14 Identity = 40/80 (50.00%), Postives = 52/80 (65.00%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TrEMBL
Match: A0A067F632_CITSI (Protein DETOXIFICATION OS=Citrus sinensis GN=CISIN_1g010345mg PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TrEMBL
Match: V4UR20_9ROSI (Protein DETOXIFICATION OS=Citrus clementina GN=CICLE_v10008114mg PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TrEMBL
Match: A0A067F9N3_CITSI (Protein DETOXIFICATION OS=Citrus sinensis GN=CISIN_1g010345mg PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TrEMBL
Match: A0A067F671_CITSI (Protein DETOXIFICATION OS=Citrus sinensis GN=CISIN_1g010345mg PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TrEMBL
Match: W1PCG4_AMBTC (Protein DETOXIFICATION OS=Amborella trichopoda GN=AMTR_s00006p00126430 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.0e-20 Identity = 56/80 (70.00%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TAIR10
Match: AT1G73700.1 (AT1G73700.1 MATE efflux family protein) HSP 1 Score: 93.6 bits (231), Expect = 6.0e-20 Identity = 47/80 (58.75%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TAIR10
Match: AT5G52450.1 (AT5G52450.1 MATE efflux family protein) HSP 1 Score: 87.8 bits (216), Expect = 3.3e-18 Identity = 46/80 (57.50%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TAIR10
Match: AT2G34360.1 (AT2G34360.1 MATE efflux family protein) HSP 1 Score: 84.3 bits (207), Expect = 3.6e-17 Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TAIR10
Match: AT3G23550.1 (AT3G23550.1 MATE efflux family protein) HSP 1 Score: 78.6 bits (192), Expect = 2.0e-15 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of CmaCh10G003170 vs. TAIR10
Match: AT3G23560.1 (AT3G23560.1 MATE efflux family protein) HSP 1 Score: 77.4 bits (189), Expect = 4.4e-15 Identity = 40/80 (50.00%), Postives = 52/80 (65.00%), Query Frame = 1
BLAST of CmaCh10G003170 vs. NCBI nr
Match: gi|641843943|gb|KDO62839.1| (hypothetical protein CISIN_1g010345mg [Citrus sinensis]) HSP 1 Score: 109.0 bits (271), Expect = 3.9e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. NCBI nr
Match: gi|567919360|ref|XP_006451686.1| (hypothetical protein CICLE_v10008114mg [Citrus clementina]) HSP 1 Score: 109.0 bits (271), Expect = 3.9e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. NCBI nr
Match: gi|641843942|gb|KDO62838.1| (hypothetical protein CISIN_1g010345mg [Citrus sinensis]) HSP 1 Score: 109.0 bits (271), Expect = 3.9e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. NCBI nr
Match: gi|641843944|gb|KDO62840.1| (hypothetical protein CISIN_1g010345mg [Citrus sinensis]) HSP 1 Score: 109.0 bits (271), Expect = 3.9e-21 Identity = 51/79 (64.56%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of CmaCh10G003170 vs. NCBI nr
Match: gi|1000940582|ref|XP_002532520.2| (PREDICTED: LOW QUALITY PROTEIN: protein DETOXIFICATION 16 [Ricinus communis]) HSP 1 Score: 107.8 bits (268), Expect = 8.7e-21 Identity = 53/80 (66.25%), Postives = 66/80 (82.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |