CmaCh07G010300 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGCGAGAGAAGGCTATAGAAGAAGCGCAGAGGACATTGGAGGCAATAGAGAGTGAGCTTGAAAACAAGTTCTTTGGAGGAGAGGAAATTGGGTTGGTGGACATCGTAGGCCTTATTTTAGCCGGCTGGATTCCTGCCACTGAACAAGCTTTTAGGATATGAGCTGCACATAGCCCACAAGTTCCCAAACCTGACAAAATGGATTGAAGAGTTCGTGAACCATAGCGTGCCCAAGCAGGTTATGCCTAAAAAGGATGCGTTTCTGGCCTTTCTTAAAAATGTTTCTGGCCTTTCTTAA ATGAAGCGAGAGAAGGCTATAGAAGAAGCGCAGAGGACATTGGAGGCAATAGAGAGTGAGCTTGAAAACAAGTTCTTTGGAGGAGAGGAAATTGGGTTGGTGGACATCCCGGCTGGATTCCTGCCACTGAACAAGCTTTTAGGATATGAGCTGCACATAGCCCACAAGTTCCCAAACCTGACAAAATGGATTGAAGAGTTCGTGAACCATAGCGTGCCCAAGCAGGTTATGCCTAAAAAGGATGCGTTTCTGGCCTTTCTTAAAAATGTTTCTGGCCTTTCTTAA ATGAAGCGAGAGAAGGCTATAGAAGAAGCGCAGAGGACATTGGAGGCAATAGAGAGTGAGCTTGAAAACAAGTTCTTTGGAGGAGAGGAAATTGGGTTGGTGGACATCCCGGCTGGATTCCTGCCACTGAACAAGCTTTTAGGATATGAGCTGCACATAGCCCACAAGTTCCCAAACCTGACAAAATGGATTGAAGAGTTCGTGAACCATAGCGTGCCCAAGCAGGTTATGCCTAAAAAGGATGCGTTTCTGGCCTTTCTTAAAAATGTTTCTGGCCTTTCTTAA MKREKAIEEAQRTLEAIESELENKFFGGEEIGLVDIPAGFLPLNKLLGYELHIAHKFPNLTKWIEEFVNHSVPKQVMPKKDAFLAFLKNVSGLS
BLAST of CmaCh07G010300 vs. Swiss-Prot
Match: GSTX6_SOYBN (Probable glutathione S-transferase OS=Glycine max GN=HSP26-A PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-13 Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 1
BLAST of CmaCh07G010300 vs. Swiss-Prot
Match: GSTU8_ARATH (Glutathione S-transferase U8 OS=Arabidopsis thaliana GN=GSTU8 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-11 Identity = 39/97 (40.21%), Postives = 58/97 (59.79%), Query Frame = 1
BLAST of CmaCh07G010300 vs. Swiss-Prot
Match: GST23_MAIZE (Glutathione transferase GST 23 OS=Zea mays PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.2e-06 Identity = 30/89 (33.71%), Postives = 49/89 (55.06%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TrEMBL
Match: A0A0A0KXR4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G303170 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.2e-21 Identity = 58/95 (61.05%), Postives = 73/95 (76.84%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TrEMBL
Match: A0A0A0L149_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G303160 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.8e-17 Identity = 48/95 (50.53%), Postives = 66/95 (69.47%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TrEMBL
Match: G7L5L9_MEDTR (Glutathione S-transferase, amino-terminal domain protein OS=Medicago truncatula GN=MTR_7g065230 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.3e-16 Identity = 41/87 (47.13%), Postives = 62/87 (71.26%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TrEMBL
Match: A0A0B2PBQ3_GLYSO (Putative glutathione S-transferase OS=Glycine soja GN=glysoja_034939 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.4e-15 Identity = 46/93 (49.46%), Postives = 64/93 (68.82%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TrEMBL
Match: Q9FQF1_SOYBN (Glutathione S-transferase GST 7 OS=Glycine max GN=GSTU26 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.4e-15 Identity = 46/93 (49.46%), Postives = 64/93 (68.82%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TAIR10
Match: AT3G09270.1 (AT3G09270.1 glutathione S-transferase TAU 8) HSP 1 Score: 69.7 bits (169), Expect = 1.1e-12 Identity = 39/97 (40.21%), Postives = 58/97 (59.79%), Query Frame = 1
BLAST of CmaCh07G010300 vs. TAIR10
Match: AT2G29460.1 (AT2G29460.1 glutathione S-transferase tau 4) HSP 1 Score: 48.5 bits (114), Expect = 2.6e-06 Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 1
BLAST of CmaCh07G010300 vs. NCBI nr
Match: gi|449460359|ref|XP_004147913.1| (PREDICTED: glutathione S-transferase U8-like [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 4.6e-21 Identity = 58/95 (61.05%), Postives = 73/95 (76.84%), Query Frame = 1
BLAST of CmaCh07G010300 vs. NCBI nr
Match: gi|659069200|ref|XP_008448631.1| (PREDICTED: glutathione S-transferase U8-like [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 8.6e-20 Identity = 55/95 (57.89%), Postives = 72/95 (75.79%), Query Frame = 1
BLAST of CmaCh07G010300 vs. NCBI nr
Match: gi|659069198|ref|XP_008448618.1| (PREDICTED: glutathione S-transferase U8-like [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 2.3e-17 Identity = 50/95 (52.63%), Postives = 65/95 (68.42%), Query Frame = 1
BLAST of CmaCh07G010300 vs. NCBI nr
Match: gi|778693596|ref|XP_011653661.1| (PREDICTED: glutathione S-transferase U8 [Cucumis sativus]) HSP 1 Score: 95.1 bits (235), Expect = 6.8e-17 Identity = 48/95 (50.53%), Postives = 66/95 (69.47%), Query Frame = 1
BLAST of CmaCh07G010300 vs. NCBI nr
Match: gi|357505759|ref|XP_003623168.1| (glutathione S-transferase, amino-terminal domain protein [Medicago truncatula]) HSP 1 Score: 91.7 bits (226), Expect = 7.5e-16 Identity = 41/87 (47.13%), Postives = 62/87 (71.26%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |