CmaCh06G015380 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACCGCTAATGGACTTGTGATGGTGGGTGAGGTTACATCTCTTGTGAGCTCTTTGTGGAAGGCGCTCGGGCTGCCAGAAACAGGGCGACAACTCCGAGCAAAAGAGCTCGATGAAGAAGATGAAGAGGAAGAGCCATCTTGGGTCAATGACAGGCGAGGGCTACTCCAAGCCACTGGTGCCAAGATTAGGGCAAATGTGGTGGTGGCTAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAA ATGACCGCTAATGGACTTGTGATGGTGGGTGAGGTTACATCTCTTGTGAGCTCTTTGTGGAAGGCGCTCGGGCTGCCAGAAACAGGGCGACAACTCCGAGCAAAAGAGCTCGATGAAGAAGATGAAGAGGAAGAGCCATCTTGGGTCAATGACAGGCGAGGGCTACTCCAAGCCACTGGTGCCAAGATTAGGGCAAATGTGGTGGTGGCTAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAA ATGACCGCTAATGGACTTGTGATGGTGGGTGAGGTTACATCTCTTGTGAGCTCTTTGTGGAAGGCGCTCGGGCTGCCAGAAACAGGGCGACAACTCCGAGCAAAAGAGCTCGATGAAGAAGATGAAGAGGAAGAGCCATCTTGGGTCAATGACAGGCGAGGGCTACTCCAAGCCACTGGTGCCAAGATTAGGGCAAATGTGGTGGTGGCTAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAAAAGACGGAAGTGGAAAGTACAAGACAATAACTCAAGCCCTTCAAGATGTCCCAAGGAAGAGCAATAA MTANGLVMVGEVTSLVSSLWKALGLPETGRQLRAKELDEEDEEEEPSWVNDRRGLLQATGAKIRANVVVAKDGSGKYKTITQALQDVPRKSNKRRKWKVQDNNSSPSRCPKEEQ
BLAST of CmaCh06G015380 vs. Swiss-Prot
Match: PME58_ARATH (Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana GN=PME58 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.4e-08 Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of CmaCh06G015380 vs. Swiss-Prot
Match: PME28_ARATH (Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 9.2e-08 Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 1
BLAST of CmaCh06G015380 vs. Swiss-Prot
Match: PME21_ARATH (Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 1.2e-07 Identity = 41/95 (43.16%), Postives = 59/95 (62.11%), Query Frame = 1
BLAST of CmaCh06G015380 vs. Swiss-Prot
Match: PME24_ARATH (Putative pectinesterase/pectinesterase inhibitor 24 OS=Arabidopsis thaliana GN=PME24 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 7.8e-07 Identity = 38/84 (45.24%), Postives = 51/84 (60.71%), Query Frame = 1
BLAST of CmaCh06G015380 vs. Swiss-Prot
Match: PME22_SOLLC (Pectinesterase 2.2 OS=Solanum lycopersicum GN=PME2.2 PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.9e-06 Identity = 26/50 (52.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TrEMBL
Match: A0A0A0L930_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_3G164510 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TrEMBL
Match: W9S1C5_9ROSA (Pectinesterase OS=Morus notabilis GN=L484_007196 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.6e-12 Identity = 46/95 (48.42%), Postives = 69/95 (72.63%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TrEMBL
Match: A0A0A0KD24_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_6G318700 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.1e-10 Identity = 46/94 (48.94%), Postives = 64/94 (68.09%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TrEMBL
Match: M0ZL18_SOLTU (Pectinesterase OS=Solanum tuberosum GN=PGSC0003DMG400001193 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-08 Identity = 39/96 (40.62%), Postives = 60/96 (62.50%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TrEMBL
Match: B9HXR2_POPTR (Pectinesterase OS=Populus trichocarpa GN=POPTR_0010s01380g PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.7e-08 Identity = 43/96 (44.79%), Postives = 63/96 (65.62%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TAIR10
Match: AT5G49180.1 (AT5G49180.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 58.5 bits (140), Expect = 3.0e-09 Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TAIR10
Match: AT5G27870.1 (AT5G27870.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 57.8 bits (138), Expect = 5.2e-09 Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TAIR10
Match: AT3G05610.1 (AT3G05610.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 57.4 bits (137), Expect = 6.7e-09 Identity = 41/95 (43.16%), Postives = 59/95 (62.11%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TAIR10
Match: AT3G10710.1 (AT3G10710.1 root hair specific 12) HSP 1 Score: 54.7 bits (130), Expect = 4.4e-08 Identity = 38/84 (45.24%), Postives = 51/84 (60.71%), Query Frame = 1
BLAST of CmaCh06G015380 vs. TAIR10
Match: AT3G06830.1 (AT3G06830.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 47.8 bits (112), Expect = 5.3e-06 Identity = 37/97 (38.14%), Postives = 55/97 (56.70%), Query Frame = 1
BLAST of CmaCh06G015380 vs. NCBI nr
Match: gi|659076869|ref|XP_008438906.1| (PREDICTED: pectinesterase-like [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 1.1e-21 Identity = 59/93 (63.44%), Postives = 75/93 (80.65%), Query Frame = 1
BLAST of CmaCh06G015380 vs. NCBI nr
Match: gi|778678954|ref|XP_004134493.2| (PREDICTED: pectinesterase-like [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 3.2e-21 Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 1
BLAST of CmaCh06G015380 vs. NCBI nr
Match: gi|703132462|ref|XP_010105131.1| (Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]) HSP 1 Score: 78.6 bits (192), Expect = 8.0e-12 Identity = 46/95 (48.42%), Postives = 69/95 (72.63%), Query Frame = 1
BLAST of CmaCh06G015380 vs. NCBI nr
Match: gi|702264392|ref|XP_010039612.1| (PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 [Eucalyptus grandis]) HSP 1 Score: 77.0 bits (188), Expect = 2.3e-11 Identity = 47/94 (50.00%), Postives = 65/94 (69.15%), Query Frame = 1
BLAST of CmaCh06G015380 vs. NCBI nr
Match: gi|1009163283|ref|XP_015899883.1| (PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 isoform X1 [Ziziphus jujuba]) HSP 1 Score: 75.5 bits (184), Expect = 6.8e-11 Identity = 43/93 (46.24%), Postives = 62/93 (66.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |