CmaCh06G015360 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGGGCGATTTTGCTCTCAAGACTTTGTTTTACACAGAATTTGATAACAGAGGACCTGGTTCCATGGGAGGGCGATTTTGCTCTCAAGACTTTGTTTTACACAGAATTTGATAACAGAGGACCTGGTGCAGCAAAACAAAATAGAGTTAAGTGGAGGGGAATTAAACAAATCACACCAAAGCATGCCATTGATTTCACCCCTGGGTTGTTTATTCGTGGTAATCCCTGGATTAGGCGCACTGGAGTTCCTTACTATTCGGGCATGGCAACGATCTAA ATGGGAGGGCGATTTTGCTCTCAAGACTTTAATTTGATAACAGAGGACCTGGTTCCATGGGAGGGCGATTTTGCTCTCAAGACTTTGTTTTACACAGAATTTGATAACAGAGGACCTGGTGCAGCAAAACAAAATAGAGTTAAGTGGAGGGGAATTAAACAAATCACACCAAAGCATGCCATTGATTTCACCCCTGGGTTGTTTATTCGTGGTAATCCCTGGATTAGGCGCACTGGAGTTCCTTACTATTCGGGCATGGCAACGATCTAA ATGGGAGGGCGATTTTGCTCTCAAGACTTTAATTTGATAACAGAGGACCTGGTTCCATGGGAGGGCGATTTTGCTCTCAAGACTTTGTTTTACACAGAATTTGATAACAGAGGACCTGGTGCAGCAAAACAAAATAGAGTTAAGTGGAGGGGAATTAAACAAATCACACCAAAGCATGCCATTGATTTCACCCCTGGGTTGTTTATTCGTGGTAATCCCTGGATTAGGCGCACTGGAGTTCCTTACTATTCGGGCATGGCAACGATCTAA MGGRFCSQDFNLITEDLVPWEGDFALKTLFYTEFDNRGPGAAKQNRVKWRGIKQITPKHAIDFTPGLFIRGNPWIRRTGVPYYSGMATI
BLAST of CmaCh06G015360 vs. Swiss-Prot
Match: PME58_ARATH (Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana GN=PME58 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.5e-18 Identity = 37/65 (56.92%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of CmaCh06G015360 vs. Swiss-Prot
Match: PME21_ARATH (Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2) HSP 1 Score: 87.4 bits (215), Expect = 8.4e-17 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of CmaCh06G015360 vs. Swiss-Prot
Match: PME23_ARATH (Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana GN=PME23 PE=2 SV=3) HSP 1 Score: 87.0 bits (214), Expect = 1.1e-16 Identity = 36/65 (55.38%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of CmaCh06G015360 vs. Swiss-Prot
Match: PME43_ARATH (Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana GN=PME43 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.9e-16 Identity = 36/68 (52.94%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of CmaCh06G015360 vs. Swiss-Prot
Match: PME2_CITSI (Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.1e-15 Identity = 36/68 (52.94%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TrEMBL
Match: A0A0A0L930_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_3G164510 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.4e-23 Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TrEMBL
Match: A0A0A0LYF5_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_1G569220 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-22 Identity = 45/72 (62.50%), Postives = 58/72 (80.56%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TrEMBL
Match: D7U9X3_VITVI (Pectinesterase OS=Vitis vinifera GN=VIT_14s0060g01950 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-22 Identity = 48/72 (66.67%), Postives = 55/72 (76.39%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TrEMBL
Match: W9S2R1_9ROSA (Pectinesterase OS=Morus notabilis GN=L484_001919 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.3e-21 Identity = 45/73 (61.64%), Postives = 57/73 (78.08%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TrEMBL
Match: W9S1C5_9ROSA (Pectinesterase OS=Morus notabilis GN=L484_007196 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.7e-20 Identity = 43/75 (57.33%), Postives = 54/75 (72.00%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TAIR10
Match: AT5G49180.1 (AT5G49180.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 93.2 bits (230), Expect = 8.7e-20 Identity = 37/65 (56.92%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TAIR10
Match: AT3G05610.1 (AT3G05610.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 87.4 bits (215), Expect = 4.8e-18 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TAIR10
Match: AT3G06830.1 (AT3G06830.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 87.0 bits (214), Expect = 6.2e-18 Identity = 36/65 (55.38%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TAIR10
Match: AT4G15980.1 (AT4G15980.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 86.3 bits (212), Expect = 1.1e-17 Identity = 36/68 (52.94%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of CmaCh06G015360 vs. TAIR10
Match: AT5G27870.1 (AT5G27870.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 82.4 bits (202), Expect = 1.5e-16 Identity = 34/68 (50.00%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of CmaCh06G015360 vs. NCBI nr
Match: gi|659076869|ref|XP_008438906.1| (PREDICTED: pectinesterase-like [Cucumis melo]) HSP 1 Score: 122.9 bits (307), Expect = 2.9e-25 Identity = 53/84 (63.10%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of CmaCh06G015360 vs. NCBI nr
Match: gi|778678954|ref|XP_004134493.2| (PREDICTED: pectinesterase-like [Cucumis sativus]) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 1
BLAST of CmaCh06G015360 vs. NCBI nr
Match: gi|296089718|emb|CBI39537.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 113.2 bits (282), Expect = 2.3e-22 Identity = 48/72 (66.67%), Postives = 55/72 (76.39%), Query Frame = 1
BLAST of CmaCh06G015360 vs. NCBI nr
Match: gi|731415746|ref|XP_010659656.1| (PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 [Vitis vinifera]) HSP 1 Score: 113.2 bits (282), Expect = 2.3e-22 Identity = 48/72 (66.67%), Postives = 55/72 (76.39%), Query Frame = 1
BLAST of CmaCh06G015360 vs. NCBI nr
Match: gi|449435986|ref|XP_004135775.1| (PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 [Cucumis sativus]) HSP 1 Score: 113.2 bits (282), Expect = 2.3e-22 Identity = 45/72 (62.50%), Postives = 58/72 (80.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |