CmaCh06G015270 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAGTGATGAGCCCACTGGTATCGTCCTCCAAAATTGCACCATCTCTTCCGACCCTGACTACTACCCCGTTCGCCATACCAGTAAGTCCTACCTTGGTCGCCCATGGAAGCAATATTCAAGGACCGTCGTCATGCAAAGCCAAATCGACGACTTGATCCAGCCTGAAGGTTGGCTTCCATGGAATGGTGATTTTGCTCTCAATACTTTGTATTACACGGAGTTTGACAACAGAGGACCTGGTGCAGCAAAAGAAAATAGAGTTAAGTGGAAGGGAATTAAGCAGATCACCGCAAAAGAGGCCATCAATTTCACCCCTTCGTTGTTTATTCATGGTGATTCTTGGATCAAGAACACCGGAATATCCTACACGGGTGCCTTGATGAAAATCTAA ATGGAGAGTGATGAGCCCACTGGTATCGTCCTCCAAAATTGCACCATCTCTTCCGACCCTGACTACTACCCCGTTCGCCATACCAGTAAGTCCTACCTTGGTCGCCCATGGAAGCAATATTCAAGGACCGTCGTCATGCAAAGCCAAATCGACGACTTGATCCAGCCTGAAGGTTGGCTTCCATGGAATGGTGATTTTGCTCTCAATACTTTGTATTACACGGAGTTTGACAACAGAGGACCTGGTGCAGCAAAAGAAAATAGAGTTAAGTGGAAGGGAATTAAGCAGATCACCGCAAAAGAGGCCATCAATTTCACCCCTTCGTTGTTTATTCATGGTGATTCTTGGATCAAGAACACCGGAATATCCTACACGGGTGCCTTGATGAAAATCTAA ATGGAGAGTGATGAGCCCACTGGTATCGTCCTCCAAAATTGCACCATCTCTTCCGACCCTGACTACTACCCCGTTCGCCATACCAGTAAGTCCTACCTTGGTCGCCCATGGAAGCAATATTCAAGGACCGTCGTCATGCAAAGCCAAATCGACGACTTGATCCAGCCTGAAGGTTGGCTTCCATGGAATGGTGATTTTGCTCTCAATACTTTGTATTACACGGAGTTTGACAACAGAGGACCTGGTGCAGCAAAAGAAAATAGAGTTAAGTGGAAGGGAATTAAGCAGATCACCGCAAAAGAGGCCATCAATTTCACCCCTTCGTTGTTTATTCATGGTGATTCTTGGATCAAGAACACCGGAATATCCTACACGGGTGCCTTGATGAAAATCTAA MESDEPTGIVLQNCTISSDPDYYPVRHTSKSYLGRPWKQYSRTVVMQSQIDDLIQPEGWLPWNGDFALNTLYYTEFDNRGPGAAKENRVKWKGIKQITAKEAINFTPSLFIHGDSWIKNTGISYTGALMKI
BLAST of CmaCh06G015270 vs. Swiss-Prot
Match: PME58_ARATH (Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana GN=PME58 PE=2 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 5.0e-42 Identity = 69/122 (56.56%), Postives = 94/122 (77.05%), Query Frame = 1
BLAST of CmaCh06G015270 vs. Swiss-Prot
Match: PME21_ARATH (Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2) HSP 1 Score: 165.6 bits (418), Expect = 3.6e-40 Identity = 67/125 (53.60%), Postives = 89/125 (71.20%), Query Frame = 1
BLAST of CmaCh06G015270 vs. Swiss-Prot
Match: PME23_ARATH (Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana GN=PME23 PE=2 SV=3) HSP 1 Score: 161.0 bits (406), Expect = 8.8e-39 Identity = 65/121 (53.72%), Postives = 90/121 (74.38%), Query Frame = 1
BLAST of CmaCh06G015270 vs. Swiss-Prot
Match: PME28_ARATH (Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 2.0e-38 Identity = 66/120 (55.00%), Postives = 86/120 (71.67%), Query Frame = 1
BLAST of CmaCh06G015270 vs. Swiss-Prot
Match: PME43_ARATH (Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana GN=PME43 PE=2 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 9.1e-36 Identity = 62/120 (51.67%), Postives = 88/120 (73.33%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TrEMBL
Match: A0A0A0L930_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_3G164510 PE=4 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 1.2e-50 Identity = 86/127 (67.72%), Postives = 107/127 (84.25%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TrEMBL
Match: A0A061EQE7_THECC (Pectinesterase OS=Theobroma cacao GN=TCM_021251 PE=4 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.5e-45 Identity = 80/130 (61.54%), Postives = 102/130 (78.46%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TrEMBL
Match: A0A067K7P3_JATCU (Pectinesterase OS=Jatropha curcas GN=JCGZ_18914 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 1.3e-44 Identity = 80/130 (61.54%), Postives = 103/130 (79.23%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TrEMBL
Match: A0A067JYH5_JATCU (Pectinesterase OS=Jatropha curcas GN=JCGZ_18913 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 8.3e-44 Identity = 80/130 (61.54%), Postives = 103/130 (79.23%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TrEMBL
Match: B9HXR2_POPTR (Pectinesterase OS=Populus trichocarpa GN=POPTR_0010s01380g PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 2.4e-43 Identity = 76/128 (59.38%), Postives = 100/128 (78.12%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TAIR10
Match: AT5G49180.1 (AT5G49180.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 171.8 bits (434), Expect = 2.8e-43 Identity = 69/122 (56.56%), Postives = 94/122 (77.05%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TAIR10
Match: AT3G05610.1 (AT3G05610.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 165.6 bits (418), Expect = 2.0e-41 Identity = 67/125 (53.60%), Postives = 89/125 (71.20%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TAIR10
Match: AT3G06830.1 (AT3G06830.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 161.0 bits (406), Expect = 5.0e-40 Identity = 65/121 (53.72%), Postives = 90/121 (74.38%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TAIR10
Match: AT5G27870.1 (AT5G27870.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-39 Identity = 66/120 (55.00%), Postives = 86/120 (71.67%), Query Frame = 1
BLAST of CmaCh06G015270 vs. TAIR10
Match: AT4G15980.1 (AT4G15980.1 Plant invertase/pectin methylesterase inhibitor superfamily) HSP 1 Score: 151.0 bits (380), Expect = 5.2e-37 Identity = 62/120 (51.67%), Postives = 88/120 (73.33%), Query Frame = 1
BLAST of CmaCh06G015270 vs. NCBI nr
Match: gi|778678954|ref|XP_004134493.2| (PREDICTED: pectinesterase-like [Cucumis sativus]) HSP 1 Score: 207.2 bits (526), Expect = 1.7e-50 Identity = 86/127 (67.72%), Postives = 107/127 (84.25%), Query Frame = 1
BLAST of CmaCh06G015270 vs. NCBI nr
Match: gi|659076869|ref|XP_008438906.1| (PREDICTED: pectinesterase-like [Cucumis melo]) HSP 1 Score: 204.5 bits (519), Expect = 1.1e-49 Identity = 86/127 (67.72%), Postives = 105/127 (82.68%), Query Frame = 1
BLAST of CmaCh06G015270 vs. NCBI nr
Match: gi|590661338|ref|XP_007035646.1| (Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao]) HSP 1 Score: 190.3 bits (482), Expect = 2.2e-45 Identity = 80/130 (61.54%), Postives = 102/130 (78.46%), Query Frame = 1
BLAST of CmaCh06G015270 vs. NCBI nr
Match: gi|802701836|ref|XP_012083982.1| (PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 [Jatropha curcas]) HSP 1 Score: 187.2 bits (474), Expect = 1.8e-44 Identity = 80/130 (61.54%), Postives = 103/130 (79.23%), Query Frame = 1
BLAST of CmaCh06G015270 vs. NCBI nr
Match: gi|1009163283|ref|XP_015899883.1| (PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 isoform X1 [Ziziphus jujuba]) HSP 1 Score: 186.8 bits (473), Expect = 2.4e-44 Identity = 77/126 (61.11%), Postives = 99/126 (78.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |