CmaCh06G009590 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCACCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCCCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCACCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCACCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCCCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCACCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCACCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCCCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCACCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA MANKPLGSTGEFFRRTDEWRKHPMLTNQFRHATPGLGIALVAFGIYLVGEQVYNRIHSPSSSHHHHADASSATH
BLAST of CmaCh06G009590 vs. Swiss-Prot
Match: NDB3B_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B OS=Arabidopsis thaliana GN=At1g14450 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 2.9e-23 Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of CmaCh06G009590 vs. Swiss-Prot
Match: NDB3A_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A OS=Arabidopsis thaliana GN=At2g02510 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.0e-20 Identity = 42/62 (67.74%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TrEMBL
Match: A0A0A0KR92_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G528700 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 4.9e-33 Identity = 69/74 (93.24%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TrEMBL
Match: A0A0B0NDD3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_04523 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.0e-27 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TrEMBL
Match: A0A0D2QHQ5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G167700 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.0e-27 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TrEMBL
Match: B9S045_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1297890 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.7e-25 Identity = 56/71 (78.87%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TrEMBL
Match: A9PCK4_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s23900g PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.1e-24 Identity = 56/66 (84.85%), Postives = 60/66 (90.91%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TAIR10
Match: AT1G14450.1 (AT1G14450.1 NADH dehydrogenase (ubiquinone)s) HSP 1 Score: 108.6 bits (270), Expect = 1.7e-24 Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of CmaCh06G009590 vs. TAIR10
Match: AT2G02510.1 (AT2G02510.1 NADH dehydrogenase (ubiquinone)s) HSP 1 Score: 98.2 bits (243), Expect = 2.2e-21 Identity = 42/62 (67.74%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of CmaCh06G009590 vs. NCBI nr
Match: gi|659121279|ref|XP_008460580.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 151.4 bits (381), Expect = 6.3e-34 Identity = 71/74 (95.95%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of CmaCh06G009590 vs. NCBI nr
Match: gi|778703796|ref|XP_011655428.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-33 Identity = 69/74 (93.24%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of CmaCh06G009590 vs. NCBI nr
Match: gi|823224383|ref|XP_012444958.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 128.3 bits (321), Expect = 5.7e-27 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 1
BLAST of CmaCh06G009590 vs. NCBI nr
Match: gi|255556661|ref|XP_002519364.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 121.7 bits (304), Expect = 5.4e-25 Identity = 56/71 (78.87%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of CmaCh06G009590 vs. NCBI nr
Match: gi|566168345|ref|XP_006385098.1| (hypothetical protein POPTR_0004s23900g [Populus trichocarpa]) HSP 1 Score: 120.2 bits (300), Expect = 1.6e-24 Identity = 56/66 (84.85%), Postives = 60/66 (90.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|