CmaCh06G008890 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGGTAGAATACTTTATGAAATGAGTGGAGTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAAAAAAAAAATCCCTCCAACTTTCTAAAATAGTCCCTACGGGTACGTATATTTTCAGACAAACTCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGGTAGAATACTTTATGAAATGAGTGGAGTAGCCGAAAATATAGCCAGAAAACTGAGATAA ATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGACAAACTCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGGTAGAATACTTTATGAAATGAGTGGAGTAGCCGAAAATATAGCCAGAAAACTGAGATAA ATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGACAAACTCGTTACACTAAGACCCACAGAAACACGTATGGGTTCAGGGAAAGGATCCCCCGAATATTGGGTAGCTGTTGTTAAATCAGGTAGAATACTTTATGAAATGAGTGGAGTAGCCGAAAATATAGCCAGAAAACTGAGATAA MGSGKGSPEYWVAVVKSDKLVTLRPTETRMGSGKGSPEYWVAVVKSGRILYEMSGVAENIARKLR
BLAST of CmaCh06G008890 vs. Swiss-Prot
Match: RK16_CITSI (50S ribosomal protein L16, chloroplastic OS=Citrus sinensis GN=rpl16 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-18 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. Swiss-Prot
Match: RK16_CUCSA (50S ribosomal protein L16, chloroplastic OS=Cucumis sativus GN=rpl16 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-18 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. Swiss-Prot
Match: RK16_GOSHI (50S ribosomal protein L16, chloroplastic OS=Gossypium hirsutum GN=rpl16 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-18 Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. Swiss-Prot
Match: RK16_GOSBA (50S ribosomal protein L16, chloroplastic OS=Gossypium barbadense GN=rpl16 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-18 Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. Swiss-Prot
Match: RK16_CARPA (50S ribosomal protein L16, chloroplastic OS=Carica papaya GN=rpl16 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-18 Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TrEMBL
Match: C6L8A4_CITNA (50S ribosomal protein L16, chloroplastic (Fragment) OS=Citrus natsudaidai PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TrEMBL
Match: X2EZK1_LAGSI (50S ribosomal protein L16, chloroplastic OS=Lagenaria siceraria GN=rpl16 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TrEMBL
Match: W8E710_9ROSI (Ribosomal protein L16 OS=Cucumis hystrix GN=rpl16 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TrEMBL
Match: C6L8A6_9ROSI (50S ribosomal protein L16, chloroplastic (Fragment) OS=Citrus hassaku PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TrEMBL
Match: C6L8A3_CITRE (50S ribosomal protein L16, chloroplastic (Fragment) OS=Citrus reticulata PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TAIR10
Match: ATCG00790.1 (ATCG00790.1 ribosomal protein L16) HSP 1 Score: 84.7 bits (208), Expect = 2.3e-17 Identity = 41/53 (77.36%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TAIR10
Match: AT2G28830.1 (AT2G28830.1 PLANT U-BOX 12) HSP 1 Score: 72.0 bits (175), Expect = 1.5e-13 Identity = 31/47 (65.96%), Postives = 40/47 (85.11%), Query Frame = 1
BLAST of CmaCh06G008890 vs. TAIR10
Match: ATMG00080.1 (ATMG00080.1 ribosomal protein L16) HSP 1 Score: 52.8 bits (125), Expect = 9.5e-08 Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 1
BLAST of CmaCh06G008890 vs. NCBI nr
Match: gi|115432841|gb|ABI97454.1| (ribosomal protein L16 [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. NCBI nr
Match: gi|68164841|ref|YP_247637.1| (ribosomal protein L16 [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. NCBI nr
Match: gi|595645222|gb|AHM88685.1| (ribosomal protein L16 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. NCBI nr
Match: gi|254998368|dbj|BAH88945.1| (ribosomal protein L16, partial (chloroplast) [Citrus x paradisi]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of CmaCh06G008890 vs. NCBI nr
Match: gi|700210847|gb|KGN65943.1| (50S ribosomal protein L16, chloroplastic [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|