CmaCh04G019510 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGGCGTTGTTAGACAGTACGTGAGATCCAAAACGCCGCGTTTAAGATGGACTCCTCAACTCCATAACTCCTTCCTTCTTGCCATACAATCCCTCGGTGGCCATCAAAGTAATTCTTCATTTCTTCTTTTTCTTTTTCTTATATATTTATTTTCATTTTTTATATTCTTCTTAGCAGAGGCAACCCCCAAGCTTCTACTTCAGCTGATGGATGTGAAAGGTGTCTCCATATCCCATGTTAAGAGCCATCTCCAGGTCCTCTTCATTTCTGTCAACTTTCATTTATTCTTCTTATTATTATTAATTTTATTTAACGTGTATTGTATTGTATTTGTAGATGTATAGAAGCATGAGAGGCGAGGACGTGAGAAGACATGCTGGTATATTTTGATAATTTTGATTGCATTTGCTGTTGTAGGTTTTGGTATATGTATATAAGTAAGTGAGAGATTGGGGAAATTTGCATTGGTCTCAGAGCCAAAAGCTGGAGGTGGAGAAGGAATGA ATGAGAGGCGTTGTTAGACAGTACGTGAGATCCAAAACGCCGCGTTTAAGATGGACTCCTCAACTCCATAACTCCTTCCTTCTTGCCATACAATCCCTCGGTGGCCATCAAAAGGCAACCCCCAAGCTTCTACTTCAGCTGATGGATGTGAAAGGTGTCTCCATATCCCATGTTAAGAGCCATCTCCAGATGTATAGAAGCATGAGAGGCGAGGACGTGAGAAGACATGCTGTGAGAGATTGGGGAAATTTGCATTGGTCTCAGAGCCAAAAGCTGGAGGTGGAGAAGGAATGA ATGAGAGGCGTTGTTAGACAGTACGTGAGATCCAAAACGCCGCGTTTAAGATGGACTCCTCAACTCCATAACTCCTTCCTTCTTGCCATACAATCCCTCGGTGGCCATCAAAAGGCAACCCCCAAGCTTCTACTTCAGCTGATGGATGTGAAAGGTGTCTCCATATCCCATGTTAAGAGCCATCTCCAGATGTATAGAAGCATGAGAGGCGAGGACGTGAGAAGACATGCTGTGAGAGATTGGGGAAATTTGCATTGGTCTCAGAGCCAAAAGCTGGAGGTGGAGAAGGAATGA MRGVVRQYVRSKTPRLRWTPQLHNSFLLAIQSLGGHQKATPKLLLQLMDVKGVSISHVKSHLQMYRSMRGEDVRRHAVRDWGNLHWSQSQKLEVEKE
BLAST of CmaCh04G019510 vs. Swiss-Prot
Match: MYBF_ARATH (Putative Myb family transcription factor At1g14600 OS=Arabidopsis thaliana GN=At1g14600 PE=2 SV=2) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-20 Identity = 47/67 (70.15%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of CmaCh04G019510 vs. Swiss-Prot
Match: ROLL9_ORYSJ (Probable transcription factor RL9 OS=Oryza sativa subsp. japonica GN=RL9 PE=2 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 3.9e-15 Identity = 34/61 (55.74%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of CmaCh04G019510 vs. Swiss-Prot
Match: KAN2_ARATH (Probable transcription factor KAN2 OS=Arabidopsis thaliana GN=KAN2 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.6e-15 Identity = 34/61 (55.74%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of CmaCh04G019510 vs. Swiss-Prot
Match: KAN1_ARATH (Transcription repressor KAN1 OS=Arabidopsis thaliana GN=KAN1 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-14 Identity = 33/58 (56.90%), Postives = 49/58 (84.48%), Query Frame = 1
BLAST of CmaCh04G019510 vs. Swiss-Prot
Match: KAN4_ARATH (Probable transcription factor KAN4 OS=Arabidopsis thaliana GN=KAN4 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.5e-14 Identity = 34/61 (55.74%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TrEMBL
Match: A0A072TFN8_MEDTR (Myb-like DNA-binding domain, shaqkyf class protein OS=Medicago truncatula GN=MTR_0223s0040 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 7.6e-26 Identity = 57/73 (78.08%), Postives = 67/73 (91.78%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TrEMBL
Match: V7BAB2_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G019900g PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.8e-25 Identity = 56/69 (81.16%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TrEMBL
Match: V7C4Q1_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_003G008400g PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.8e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TrEMBL
Match: K7N0L3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G006000 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.8e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TrEMBL
Match: A0A0S3T178_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.10G011200 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.8e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TAIR10
Match: AT2G40260.1 (AT2G40260.1 Homeodomain-like superfamily protein) HSP 1 Score: 102.4 bits (254), Expect = 1.6e-22 Identity = 48/70 (68.57%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TAIR10
Match: AT1G14600.1 (AT1G14600.1 Homeodomain-like superfamily protein) HSP 1 Score: 100.5 bits (249), Expect = 5.9e-22 Identity = 47/67 (70.15%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TAIR10
Match: AT2G42660.1 (AT2G42660.1 Homeodomain-like superfamily protein) HSP 1 Score: 99.0 bits (245), Expect = 1.7e-21 Identity = 46/71 (64.79%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TAIR10
Match: AT2G38300.1 (AT2G38300.1 myb-like HTH transcriptional regulator family protein) HSP 1 Score: 98.2 bits (243), Expect = 2.9e-21 Identity = 44/68 (64.71%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of CmaCh04G019510 vs. TAIR10
Match: AT2G02060.1 (AT2G02060.1 Homeodomain-like superfamily protein) HSP 1 Score: 95.1 bits (235), Expect = 2.5e-20 Identity = 43/62 (69.35%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of CmaCh04G019510 vs. NCBI nr
Match: gi|922325843|ref|XP_013442314.1| (myb-like DNA-binding domain, shaqkyf class protein [Medicago truncatula]) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-25 Identity = 57/73 (78.08%), Postives = 67/73 (91.78%), Query Frame = 1
BLAST of CmaCh04G019510 vs. NCBI nr
Match: gi|965613136|dbj|BAT98768.1| (hypothetical protein VIGAN_10011200 [Vigna angularis var. angularis]) HSP 1 Score: 122.1 bits (305), Expect = 5.4e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
BLAST of CmaCh04G019510 vs. NCBI nr
Match: gi|571563271|ref|XP_006605454.1| (PREDICTED: putative Myb family transcription factor At1g14600 [Glycine max]) HSP 1 Score: 122.1 bits (305), Expect = 5.4e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
BLAST of CmaCh04G019510 vs. NCBI nr
Match: gi|658010565|ref|XP_008340525.1| (PREDICTED: putative Myb family transcription factor At1g14600 isoform X2 [Malus domestica]) HSP 1 Score: 122.1 bits (305), Expect = 5.4e-25 Identity = 57/73 (78.08%), Postives = 65/73 (89.04%), Query Frame = 1
BLAST of CmaCh04G019510 vs. NCBI nr
Match: gi|951048693|ref|XP_014519772.1| (PREDICTED: putative Myb family transcription factor At1g14600 [Vigna radiata var. radiata]) HSP 1 Score: 122.1 bits (305), Expect = 5.4e-25 Identity = 55/73 (75.34%), Postives = 66/73 (90.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|