CmaCh04G019500 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGAATTTGCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATACCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTGTGGATGTTCCTGTGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCATTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACATGTCGAAGTGAAAGCCCCTGGGATTATTTCACGTAAATCTGTGCACTAA ATGGTGGAATTTGCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATACCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTGTGGATGTTCCTGTGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCATTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACATGTCGAAGTGAAAGCCCCTGGGATTATTTCACGTAAATCTGTGCACTAA ATGGTGGAATTTGCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATACCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTGTGGATGTTCCTGTGGGAAAGGCTATGCTCGGGCGTGTGGTCGACGCATTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACATGTCGAAGTGAAAGCCCCTGGGATTATTTCACGTAAATCTGTGCACTAA MVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPVGKAMLGRVVDALGVPIDGRGALSDHERRHVEVKAPGIISRKSVH
BLAST of CmaCh04G019500 vs. Swiss-Prot
Match: ATPAM_SOYBN (ATP synthase subunit alpha, mitochondrial OS=Glycine max GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 5.4e-43 Identity = 89/92 (96.74%), Postives = 89/92 (96.74%), Query Frame = 1
BLAST of CmaCh04G019500 vs. Swiss-Prot
Match: ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 5.4e-43 Identity = 89/92 (96.74%), Postives = 89/92 (96.74%), Query Frame = 1
BLAST of CmaCh04G019500 vs. Swiss-Prot
Match: ATPAM_HELAN (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 5.4e-43 Identity = 89/92 (96.74%), Postives = 89/92 (96.74%), Query Frame = 1
BLAST of CmaCh04G019500 vs. Swiss-Prot
Match: ATPAM_PHAVU (ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 5.4e-43 Identity = 89/92 (96.74%), Postives = 89/92 (96.74%), Query Frame = 1
BLAST of CmaCh04G019500 vs. Swiss-Prot
Match: ATPAM_WHEAT (ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum GN=ATPA PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.2e-42 Identity = 88/92 (95.65%), Postives = 89/92 (96.74%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TrEMBL
Match: E5DKE3_9ASTE (ATP synthase subunit alpha (Fragment) OS=Nyssa sylvatica GN=atp1 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 7.1e-42 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TrEMBL
Match: D5I3E1_CUCPE (ATP synthase subunit alpha OS=Cucurbita pepo GN=atp1 PE=3 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.1e-41 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TrEMBL
Match: E5DK72_CUCPE (ATP synthase subunit alpha (Fragment) OS=Cucurbita pepo GN=atp1 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.1e-41 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TrEMBL
Match: Q5VL20_HYDGA (ATP synthase subunit alpha (Fragment) OS=Hydrothrix gardneri GN=atpA PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 4.6e-41 Identity = 89/92 (96.74%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TrEMBL
Match: E1CBG2_CYCTA (ATPase subunit 1 (Fragment) OS=Cycas taitungensis GN=atp1 PE=2 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 4.6e-41 Identity = 89/92 (96.74%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TAIR10
Match: AT2G07698.1 (AT2G07698.1 ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 163.3 bits (412), Expect = 7.0e-41 Identity = 81/92 (88.04%), Postives = 87/92 (94.57%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TAIR10
Match: ATMG01190.1 (ATMG01190.1 ATP synthase subunit 1) HSP 1 Score: 163.3 bits (412), Expect = 7.0e-41 Identity = 81/92 (88.04%), Postives = 87/92 (94.57%), Query Frame = 1
BLAST of CmaCh04G019500 vs. TAIR10
Match: ATCG00120.1 (ATCG00120.1 ATP synthase subunit alpha) HSP 1 Score: 103.2 bits (256), Expect = 8.7e-23 Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
BLAST of CmaCh04G019500 vs. NCBI nr
Match: gi|302747560|gb|ADL63261.1| (Atp1, partial (mitochondrion) [Nyssa sylvatica]) HSP 1 Score: 177.6 bits (449), Expect = 1.0e-41 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. NCBI nr
Match: gi|295311673|ref|YP_003587355.1| (ATPase subunit 1 [Cucurbita pepo]) HSP 1 Score: 176.0 bits (445), Expect = 3.0e-41 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. NCBI nr
Match: gi|302747418|gb|ADL63190.1| (Atp1, partial (mitochondrion) [Cucurbita pepo]) HSP 1 Score: 176.0 bits (445), Expect = 3.0e-41 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. NCBI nr
Match: gi|380007700|gb|AFD29851.1| (ATP synthase alpha subunit, partial (mitochondrion) [Aristea ecklonii]) HSP 1 Score: 174.9 bits (442), Expect = 6.6e-41 Identity = 89/92 (96.74%), Postives = 90/92 (97.83%), Query Frame = 1
BLAST of CmaCh04G019500 vs. NCBI nr
Match: gi|308072443|dbj|BAJ22083.1| (ATPase subunit 1 [Cycas taitungensis]) HSP 1 Score: 174.9 bits (442), Expect = 6.6e-41 Identity = 89/92 (96.74%), Postives = 90/92 (97.83%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|