CmaCh04G017840 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTCTCTGTATAAACCTTACCCTCTTGGTGTTCTTCCACATTCAGCCCTTTCTCTATCTTTATCTCTCTGAGTAGAGCTTTGAAATGCTTAGCATAATAATCTCTTTATCTGGGTTCCTCTGCTTTTCCTCTGTTCTTCTCTGTTGCTTCTTAAATCCATAAGAAAACAGGCAAAACCCAACAACAAGCTTCTTCCTCCAACCCCTCCCAAGCTTCCTTTGTTGGGCCATTTGCACCTCCTTGGCTCCCTCCCTCATCGCTCTCTCTCTCAGCTTTCAAAAAAATATGGCCCCGTCATGCTTCTCCAACTGGGCTCTGTCCCAACCATCGTAGTCTCCTCTGCCGCTGCTGCAAGAGAGTTGTTCAAATTTCACGACCTTGCTTCTTGCGGCCGACCTCCCTTACACGCCAACGGACGACTTTCGTACAACTATCTTGACATGAGTCTCGCTCCATACGGTGAGCACTGA ATGGAGCTCTCTCATAATAATCTCTTTATCTGGGTTCCTCTGCTTTTCCTCTGTTCTTCTCTGTTGCTTCTTAAATCCATAAGAAAACAGGCAAAACCCAACAACAAGCTTCTTCCTCCAACCCCTCCCAAGCTTCCTTTGTTGGGCCATTTGCACCTCCTTGGCTCCCTCCCTCATCGCTCTCTCTCTCAGCTTTCAAAAAAATATGGCCCCGTCATGCTTCTCCAACTGGGCTCTGTCCCAACCATCGTAGTCTCCTCTGCCGCTGCTGCAAGAGAGTTGTTCAAATTTCACGACCTTGCTTCTTGCGGCCGACCTCCCTTACACGCCAACGGACGACTTTCGTACAACTATCTTGACATGAGTCTCGCTCCATACGGTGAGCACTGA ATGGAGCTCTCTCATAATAATCTCTTTATCTGGGTTCCTCTGCTTTTCCTCTGTTCTTCTCTGTTGCTTCTTAAATCCATAAGAAAACAGGCAAAACCCAACAACAAGCTTCTTCCTCCAACCCCTCCCAAGCTTCCTTTGTTGGGCCATTTGCACCTCCTTGGCTCCCTCCCTCATCGCTCTCTCTCTCAGCTTTCAAAAAAATATGGCCCCGTCATGCTTCTCCAACTGGGCTCTGTCCCAACCATCGTAGTCTCCTCTGCCGCTGCTGCAAGAGAGTTGTTCAAATTTCACGACCTTGCTTCTTGCGGCCGACCTCCCTTACACGCCAACGGACGACTTTCGTACAACTATCTTGACATGAGTCTCGCTCCATACGGTGAGCACTGA MELSHNNLFIWVPLLFLCSSLLLLKSIRKQAKPNNKLLPPTPPKLPLLGHLHLLGSLPHRSLSQLSKKYGPVMLLQLGSVPTIVVSSAAAARELFKFHDLASCGRPPLHANGRLSYNYLDMSLAPYGEH
BLAST of CmaCh04G017840 vs. Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2) HSP 1 Score: 124.8 bits (312), Expect = 6.9e-28 Identity = 63/121 (52.07%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of CmaCh04G017840 vs. Swiss-Prot
Match: C71A9_SOYBN (Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 9.0e-28 Identity = 66/122 (54.10%), Postives = 86/122 (70.49%), Query Frame = 1
BLAST of CmaCh04G017840 vs. Swiss-Prot
Match: C71B9_ARATH (Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3) HSP 1 Score: 122.5 bits (306), Expect = 3.4e-27 Identity = 61/121 (50.41%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of CmaCh04G017840 vs. Swiss-Prot
Match: C71BX_ARATH (Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.4e-25 Identity = 57/120 (47.50%), Postives = 85/120 (70.83%), Query Frame = 1
BLAST of CmaCh04G017840 vs. Swiss-Prot
Match: C71BV_ARATH (Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.2e-25 Identity = 57/120 (47.50%), Postives = 79/120 (65.83%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TrEMBL
Match: A0A097PUC4_POPTR (Cytochrome P450 CYP71B40v3 OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 71/120 (59.17%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TrEMBL
Match: A9PEA6_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 71/120 (59.17%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TrEMBL
Match: A0A097PUF9_POPTR (Cytochrome P450 CYP71B63v2 OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 71/120 (59.17%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TrEMBL
Match: B9HLE4_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s18810g PE=3 SV=2) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 71/120 (59.17%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TrEMBL
Match: B9HLF2_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s18870g PE=3 SV=2) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 71/120 (59.17%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TAIR10
Match: AT3G26330.1 (AT3G26330.1 cytochrome P450, family 71, subfamily B, polypeptide 37) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-29 Identity = 63/121 (52.07%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TAIR10
Match: AT2G02580.1 (AT2G02580.1 cytochrome P450, family 71, subfamily B, polypeptide 9) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-28 Identity = 61/121 (50.41%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TAIR10
Match: AT3G26320.1 (AT3G26320.1 cytochrome P450, family 71, subfamily B, polypeptide 36) HSP 1 Score: 117.1 bits (292), Expect = 8.1e-27 Identity = 57/120 (47.50%), Postives = 85/120 (70.83%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TAIR10
Match: AT3G26300.1 (AT3G26300.1 cytochrome P450, family 71, subfamily B, polypeptide 34) HSP 1 Score: 114.8 bits (286), Expect = 4.0e-26 Identity = 57/120 (47.50%), Postives = 79/120 (65.83%), Query Frame = 1
BLAST of CmaCh04G017840 vs. TAIR10
Match: AT5G57260.1 (AT5G57260.1 cytochrome P450, family 71, subfamily B, polypeptide 10) HSP 1 Score: 113.6 bits (283), Expect = 9.0e-26 Identity = 57/120 (47.50%), Postives = 82/120 (68.33%), Query Frame = 1
BLAST of CmaCh04G017840 vs. NCBI nr
Match: gi|778704855|ref|XP_004135281.2| (PREDICTED: cytochrome P450 71B2-like isoform X1 [Cucumis sativus]) HSP 1 Score: 167.2 bits (422), Expect = 1.9e-38 Identity = 84/126 (66.67%), Postives = 101/126 (80.16%), Query Frame = 1
BLAST of CmaCh04G017840 vs. NCBI nr
Match: gi|778704874|ref|XP_004135495.2| (PREDICTED: cytochrome P450 71B37-like [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 3.3e-38 Identity = 82/132 (62.12%), Postives = 104/132 (78.79%), Query Frame = 1
BLAST of CmaCh04G017840 vs. NCBI nr
Match: gi|778708641|ref|XP_011656251.1| (PREDICTED: cytochrome P450 71B10-like [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 4.3e-38 Identity = 84/127 (66.14%), Postives = 100/127 (78.74%), Query Frame = 1
BLAST of CmaCh04G017840 vs. NCBI nr
Match: gi|778704858|ref|XP_004135496.2| (PREDICTED: cytochrome P450 71B26-like isoform X2 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 1.6e-37 Identity = 85/127 (66.93%), Postives = 100/127 (78.74%), Query Frame = 1
BLAST of CmaCh04G017840 vs. NCBI nr
Match: gi|659092302|ref|XP_008447001.1| (PREDICTED: cytochrome P450 71B34-like [Cucumis melo]) HSP 1 Score: 158.7 bits (400), Expect = 6.9e-36 Identity = 81/131 (61.83%), Postives = 101/131 (77.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |