CmaCh04G017230 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTCCCAAGAAAGGGTAGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATGGACTCCCAAGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACGACGTATGATCATTACACTTCAACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAGAACTTAAATCAAAATACTTAATAGCATGGCGATATTTCATCATATCCGGGATGTGATATGGTTCTGAAGATATCTGGGATGTGA ATGGACTCCCAAGAAAGGGTAGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATGGACTCCCAAGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACGACCATGGCGATATTTCATCATATCCGGGATGTGATATGGTTCTGAAGATATCTGGGATGTGA ATGGACTCCCAAGAAAGGGTAGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATGGACTCCCAAGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACGACCATGGCGATATTTCATCATATCCGGGATGTGATATGGTTCTGAAGATATCTGGGATGTGA MDSQERVELFFGVKVIAMNSHGLPRKGRRMGPIMGHTMHYDHGDISSYPGCDMVLKISGM
BLAST of CmaCh04G017230 vs. Swiss-Prot
Match: RK23_CITSI (50S ribosomal protein L23, chloroplastic OS=Citrus sinensis GN=rpl23-A PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 6.5e-13 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 1
BLAST of CmaCh04G017230 vs. Swiss-Prot
Match: RK23_PLAOC (50S ribosomal protein L23, chloroplastic OS=Platanus occidentalis GN=rpl23-A PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.5e-13 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 1
BLAST of CmaCh04G017230 vs. Swiss-Prot
Match: RK23_VITVI (50S ribosomal protein L23, chloroplastic OS=Vitis vinifera GN=rpl23-A PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.5e-13 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 1
BLAST of CmaCh04G017230 vs. Swiss-Prot
Match: RK23_COFAR (50S ribosomal protein L23, chloroplastic OS=Coffea arabica GN=rpl23-A PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.5e-13 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 1
BLAST of CmaCh04G017230 vs. Swiss-Prot
Match: RK23_CUCSA (50S ribosomal protein L23, chloroplastic OS=Cucumis sativus GN=rpl23-A PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.5e-13 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TrEMBL
Match: A0A0U3SVK1_9ROSI (50S ribosomal protein L23, chloroplastic OS=Dipteronia sinensis GN=rpl23 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TrEMBL
Match: A0A0K0VIH5_9LILI (Ribosomal protein L23 OS=Stemona tuberosa GN=rpl23 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TrEMBL
Match: A0A0K0VIW8_9LILI (Ribosomal protein L23 OS=Stichoneuron caudatum GN=rpl23 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TrEMBL
Match: A0A0U2CJB3_PINTE (50S ribosomal protein L23, chloroplastic OS=Pinellia ternata GN=rpl23 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TrEMBL
Match: H6T273_9POAL (Ribosomal protein L23 OS=Syngonanthus chrysanthus GN=rpl23 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TAIR10
Match: ATCG00840.1 (ATCG00840.1 ribosomal protein L23.1) HSP 1 Score: 67.8 bits (164), Expect = 2.6e-12 Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = 1
BLAST of CmaCh04G017230 vs. TAIR10
Match: ATCG01300.1 (ATCG01300.1 ribosomal protein L23) HSP 1 Score: 67.8 bits (164), Expect = 2.6e-12 Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = 1
BLAST of CmaCh04G017230 vs. NCBI nr
Match: gi|937408465|ref|YP_009166647.1| (ribosomal protein L23 (chloroplast) [Epipremnum aureum]) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. NCBI nr
Match: gi|1002161074|ref|YP_009231201.1| (50S ribosomal protein L23 (chloroplast) [Dipteronia sinensis]) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. NCBI nr
Match: gi|910355699|ref|YP_009161596.1| (ribosomal protein L23 (chloroplast) [Pinellia ternata]) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. NCBI nr
Match: gi|340806763|gb|AEK71415.1| (ribosomal protein L23 [Schinus terebinthifolia]) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-11 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1
BLAST of CmaCh04G017230 vs. NCBI nr
Match: gi|814072065|ref|YP_009129831.1| (ribosomal protein L23 (chloroplast) [Vanilla planifolia]) HSP 1 Score: 75.5 bits (184), Expect = 3.6e-11 Identity = 37/51 (72.55%), Postives = 39/51 (76.47%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |