CmaCh04G010500 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGGGGCTGTAATTAGAGGCTTTGTGCCTGTTTTTCCGGCCGCGATTGCGGTGGCGGTGGTGGCGGTGTTGGTCCATTTGTACTTCTATAGTGCATGGAGGAAGACGGCGGAGCTGAGGAGGAAGCTGGGAGAACAGGGCGTGATGGGTCCGCCACCGTCGGCTCTGTTTGGTAACTTGCCGGAGATGAAGAAGATCCAGTTGGAAGCAGCAGCCATGGCTCCTCCGCCGCGTCATGCGTCGGCGATTGTGGCTCATGATTATACATCCACCGTCTTCCCTTATTTCTTTAAGTGGAGGAAGCAATAG ATGGAGGGGGCTGTAATTAGAGGCTTTGTGCCTGTTTTTCCGGCCGCGATTGCGGTGGCGGTGGTGGCGGTGTTGGTCCATTTGTACTTCTATAGTGCATGGAGGAAGACGGCGGAGCTGAGGAGGAAGCTGGGAGAACAGGGCGTGATGGGTCCGCCACCGTCGGCTCTGTTTGGTAACTTGCCGGAGATGAAGAAGATCCAGTTGGAAGCAGCAGCCATGGCTCCTCCGCCGCGTCATGCGTCGGCGATTGTGGCTCATGATTATACATCCACCGTCTTCCCTTATTTCTTTAAGTGGAGGAAGCAATAG ATGGAGGGGGCTGTAATTAGAGGCTTTGTGCCTGTTTTTCCGGCCGCGATTGCGGTGGCGGTGGTGGCGGTGTTGGTCCATTTGTACTTCTATAGTGCATGGAGGAAGACGGCGGAGCTGAGGAGGAAGCTGGGAGAACAGGGCGTGATGGGTCCGCCACCGTCGGCTCTGTTTGGTAACTTGCCGGAGATGAAGAAGATCCAGTTGGAAGCAGCAGCCATGGCTCCTCCGCCGCGTCATGCGTCGGCGATTGTGGCTCATGATTATACATCCACCGTCTTCCCTTATTTCTTTAAGTGGAGGAAGCAATAG MEGAVIRGFVPVFPAAIAVAVVAVLVHLYFYSAWRKTAELRRKLGEQGVMGPPPSALFGNLPEMKKIQLEAAAMAPPPRHASAIVAHDYTSTVFPYFFKWRKQ
BLAST of CmaCh04G010500 vs. Swiss-Prot
Match: C14A1_ARATH (Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-11 Identity = 40/92 (43.48%), Postives = 56/92 (60.87%), Query Frame = 1
BLAST of CmaCh04G010500 vs. Swiss-Prot
Match: C14A2_ARATH (Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-10 Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 1
BLAST of CmaCh04G010500 vs. Swiss-Prot
Match: C14C2_ORYSJ (Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.2e-10 Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 1
BLAST of CmaCh04G010500 vs. Swiss-Prot
Match: C14C3_ORYSJ (Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 3.5e-06 Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TrEMBL
Match: A0A0A0KQQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G224130 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.6e-32 Identity = 71/96 (73.96%), Postives = 80/96 (83.33%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TrEMBL
Match: A0A067FJN4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g009840mg PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.3e-17 Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TrEMBL
Match: A0A067FWN3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g009840mg PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.3e-17 Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TrEMBL
Match: A0A067FNA6_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g009840mg PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.3e-17 Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TrEMBL
Match: W9SQS9_9ROSA (Cytokinin hydroxylase OS=Morus notabilis GN=L484_017107 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.8e-17 Identity = 47/85 (55.29%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TAIR10
Match: AT5G24910.1 (AT5G24910.1 cytochrome P450, family 714, subfamily A, polypeptide 1) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-12 Identity = 40/92 (43.48%), Postives = 56/92 (60.87%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TAIR10
Match: AT5G24900.1 (AT5G24900.1 cytochrome P450, family 714, subfamily A, polypeptide 2) HSP 1 Score: 65.5 bits (158), Expect = 2.2e-11 Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 1
BLAST of CmaCh04G010500 vs. TAIR10
Match: AT5G52400.1 (AT5G52400.1 cytochrome P450, family 715, subfamily A, polypeptide 1) HSP 1 Score: 52.0 bits (123), Expect = 2.6e-07 Identity = 27/87 (31.03%), Postives = 47/87 (54.02%), Query Frame = 1
BLAST of CmaCh04G010500 vs. NCBI nr
Match: gi|449457460|ref|XP_004146466.1| (PREDICTED: cytochrome P450 714A1-like [Cucumis sativus]) HSP 1 Score: 152.1 bits (383), Expect = 5.2e-34 Identity = 75/103 (72.82%), Postives = 85/103 (82.52%), Query Frame = 1
BLAST of CmaCh04G010500 vs. NCBI nr
Match: gi|659130610|ref|XP_008465257.1| (PREDICTED: cytochrome P450 714A1-like [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.5e-33 Identity = 73/103 (70.87%), Postives = 85/103 (82.52%), Query Frame = 1
BLAST of CmaCh04G010500 vs. NCBI nr
Match: gi|700195580|gb|KGN50757.1| (hypothetical protein Csa_5G224130 [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 3.7e-32 Identity = 71/96 (73.96%), Postives = 80/96 (83.33%), Query Frame = 1
BLAST of CmaCh04G010500 vs. NCBI nr
Match: gi|641848739|gb|KDO67615.1| (hypothetical protein CISIN_1g009840mg [Citrus sinensis]) HSP 1 Score: 96.3 bits (238), Expect = 3.4e-17 Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of CmaCh04G010500 vs. NCBI nr
Match: gi|641848738|gb|KDO67614.1| (hypothetical protein CISIN_1g009840mg [Citrus sinensis]) HSP 1 Score: 96.3 bits (238), Expect = 3.4e-17 Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |