CmaCh03G007230 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTATTGCAGCCCTTGTGGGTTCCGGCTTCTGGCCTCCAATTACCTTGGGATTCAGAATCACGAGATGTTTAGCGAGATTGAGGAGCGGATTTTGAGCACAAAAGTGACTCCGGCGGCGGTGGCGGAGCAGCTGCTGAAAGGTGAAGACAGTGACAAAGCATTAAGGCATTTGATGGAGTTTCTGGAAGCTAAAGAACGGGAGAAAGAAGAAGCGGAGCTCAAAATCCGAGAAGATGGAGAAAAGAAGGAGAAGAAGGCGGAGAATATAAAATAA ATGTCGTATTGCAGCCCTTGTGGGTTCCGGCTTCTGGCCTCCAATTACCTTGGGATTCAGAATCACGAGATGTTTAGCGAGATTGAGGAGCGGATTTTGAGCACAAAAGTGACTCCGGCGGCGGTGGCGGAGCAGCTGCTGAAAGGTGAAGACAGTGACAAAGCATTAAGGCATTTGATGGAGTTTCTGGAAGCTAAAGAACGGGAGAAAGAAGAAGCGGAGCTCAAAATCCGAGAAGATGGAGAAAAGAAGGAGAAGAAGGCGGAGAATATAAAATAA ATGTCGTATTGCAGCCCTTGTGGGTTCCGGCTTCTGGCCTCCAATTACCTTGGGATTCAGAATCACGAGATGTTTAGCGAGATTGAGGAGCGGATTTTGAGCACAAAAGTGACTCCGGCGGCGGTGGCGGAGCAGCTGCTGAAAGGTGAAGACAGTGACAAAGCATTAAGGCATTTGATGGAGTTTCTGGAAGCTAAAGAACGGGAGAAAGAAGAAGCGGAGCTCAAAATCCGAGAAGATGGAGAAAAGAAGGAGAAGAAGGCGGAGAATATAAAATAA MSYCSPCGFRLLASNYLGIQNHEMFSEIEERILSTKVTPAAVAEQLLKGEDSDKALRHLMEFLEAKEREKEEAELKIREDGEKKEKKAENIK
BLAST of CmaCh03G007230 vs. Swiss-Prot
Match: AATPC_ARATH (AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-14 Identity = 38/68 (55.88%), Postives = 53/68 (77.94%), Query Frame = 1
BLAST of CmaCh03G007230 vs. Swiss-Prot
Match: HSR4_ARATH (Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.9e-13 Identity = 42/89 (47.19%), Postives = 61/89 (68.54%), Query Frame = 1
BLAST of CmaCh03G007230 vs. Swiss-Prot
Match: AATP2_ARATH (AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.7e-10 Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of CmaCh03G007230 vs. Swiss-Prot
Match: AATP3_ARATH (AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 7.9e-10 Identity = 40/91 (43.96%), Postives = 60/91 (65.93%), Query Frame = 1
BLAST of CmaCh03G007230 vs. Swiss-Prot
Match: AATP9_ARATH (AAA-ATPase At3g28580 OS=Arabidopsis thaliana GN=At3g28580 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.7e-09 Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TrEMBL
Match: A0A0A0KJ80_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G504450 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.7e-23 Identity = 67/96 (69.79%), Postives = 75/96 (78.12%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TrEMBL
Match: W9SKP6_9ROSA (Putative mitochondrial chaperone bcs1 OS=Morus notabilis GN=L484_026736 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.9e-18 Identity = 51/89 (57.30%), Postives = 73/89 (82.02%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TrEMBL
Match: A0A0A0KH33_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G504440 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-17 Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TrEMBL
Match: W9SN57_9ROSA (Putative mitochondrial chaperone bcs1 OS=Morus notabilis GN=L484_026737 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.0e-16 Identity = 47/89 (52.81%), Postives = 69/89 (77.53%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TrEMBL
Match: K4D2K4_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.8e-16 Identity = 46/80 (57.50%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TAIR10
Match: AT3G50940.1 (AT3G50940.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 1.0e-15 Identity = 38/68 (55.88%), Postives = 53/68 (77.94%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TAIR10
Match: AT3G50930.1 (AT3G50930.1 cytochrome BC1 synthesis) HSP 1 Score: 74.7 bits (182), Expect = 3.3e-14 Identity = 42/89 (47.19%), Postives = 61/89 (68.54%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TAIR10
Match: AT4G05380.1 (AT4G05380.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 68.6 bits (166), Expect = 2.4e-12 Identity = 34/77 (44.16%), Postives = 50/77 (64.94%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TAIR10
Match: AT2G18190.1 (AT2G18190.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.5e-11 Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of CmaCh03G007230 vs. TAIR10
Match: AT2G18193.1 (AT2G18193.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 4.5e-11 Identity = 40/91 (43.96%), Postives = 60/91 (65.93%), Query Frame = 1
BLAST of CmaCh03G007230 vs. NCBI nr
Match: gi|778719538|ref|XP_004150005.2| (PREDICTED: probable mitochondrial chaperone bcs1 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 8.1e-23 Identity = 67/96 (69.79%), Postives = 75/96 (78.12%), Query Frame = 1
BLAST of CmaCh03G007230 vs. NCBI nr
Match: gi|659081056|ref|XP_008441126.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103485356 [Cucumis melo]) HSP 1 Score: 114.4 bits (285), Expect = 1.1e-22 Identity = 65/94 (69.15%), Postives = 73/94 (77.66%), Query Frame = 1
BLAST of CmaCh03G007230 vs. NCBI nr
Match: gi|703163650|ref|XP_010113404.1| (putative mitochondrial chaperone bcs1 [Morus notabilis]) HSP 1 Score: 99.8 bits (247), Expect = 2.7e-18 Identity = 51/89 (57.30%), Postives = 73/89 (82.02%), Query Frame = 1
BLAST of CmaCh03G007230 vs. NCBI nr
Match: gi|1009144771|ref|XP_015889982.1| (PREDICTED: AAA-ATPase At3g50940-like [Ziziphus jujuba]) HSP 1 Score: 99.0 bits (245), Expect = 4.6e-18 Identity = 48/84 (57.14%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of CmaCh03G007230 vs. NCBI nr
Match: gi|700193659|gb|KGN48863.1| (hypothetical protein Csa_6G504440 [Cucumis sativus]) HSP 1 Score: 95.9 bits (237), Expect = 3.9e-17 Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |