Cla97C10G190060 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCATGGAGGTTGCTTTGACAATCGAGAATATAACAAATGACAAATTTCTTGTCCATCTAGAAAAGGTAGGTTGAGTTTGCTAATTTCAATTCTTTTCGGTTTCTCAAAGGAATTTTTACGTTAATTACATTCCATTAGGTTGCTGAGGAAAAGGGTGTGGTGGAGCTGACTGAGTTCCTAAAAGCCGAGTCCCTCTTAGACGAAGAGGTAAAAATTCAAACATAGAAATTAAACTTTCTGTAACTTTTTATTATTATTATTATTATTATTATTATTATTTTAAAGCAAGATTAGAGTGGTACACTTTTAGGTTCAAGCACATTAATGGTTGTTTTTTCTTTTTTCCAATATTGCAGGTGAAGTTAATAGAAAAAATCTCATATTGCATTGAATATCTTAGAAGGTTGGACACTGAAGAAAGTGAGTCATTTTTGCCTTTCTTATCTTGTGTTGTCATCTTTGTCCTTTCTGCCATTTTCTTGATGATATCTTAACACTTTCAGAAATATGGCGCTCCGATTCCACCTATCCACCGATGTGA CCATGGAGGTTGCTTTGACAATCGAGAATATAACAAATGACAAATTTCTTGTCCATCTAGAAAAGGTTGCTGAGGAAAAGGGTGTGGTGGAGCTGACTGAGTTCCTAAAAGCCGAGTCCCTCTTAGACGAAGAGGTGAAGTTAATAGAAAAAATCTCATATTGCATTGAATATCTTAGAAGGTTGGACACTGAAGAAAAAATATGGCGCTCCGATTCCACCTATCCACCGATGTGA CCATGGAGGTTGCTTTGACAATCGAGAATATAACAAATGACAAATTTCTTGTCCATCTAGAAAAGGTTGCTGAGGAAAAGGGTGTGGTGGAGCTGACTGAGTTCCTAAAAGCCGAGTCCCTCTTAGACGAAGAGGTGAAGTTAATAGAAAAAATCTCATATTGCATTGAATATCTTAGAAGGTTGGACACTGAAGAAAAAATATGGCGCTCCGATTCCACCTATCCACCGATGTGA MEVALTIENITNDKFLVHLEKVAEEKGVVELTEFLKAESLLDEEVKLIEKISYCIEYLRRLDTEEKIWRSDSTYPPM
BLAST of Cla97C10G190060 vs. NCBI nr
Match: XP_023536407.1 (ferritin-3, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 60.8 bits (146), Expect = 2.3e-06 Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of Cla97C10G190060 vs. NCBI nr
Match: XP_022957027.1 (ferritin-3, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 60.5 bits (145), Expect = 3.0e-06 Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of Cla97C10G190060 vs. NCBI nr
Match: XP_022977138.1 (ferritin-3, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 60.5 bits (145), Expect = 3.0e-06 Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of Cla97C10G190060 vs. NCBI nr
Match: XP_023543120.1 (ferritin-3, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 60.5 bits (145), Expect = 3.0e-06 Identity = 35/74 (47.30%), Postives = 51/74 (68.92%), Query Frame = 0
BLAST of Cla97C10G190060 vs. NCBI nr
Match: XP_022941861.1 (ferritin-3, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 57.8 bits (138), Expect = 1.9e-05 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TrEMBL
Match: tr|A0A1S3C0P9|A0A1S3C0P9_CUCME (Ferritin OS=Cucumis melo OX=3656 GN=LOC103495136 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.7e-05 Identity = 33/71 (46.48%), Postives = 50/71 (70.42%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TrEMBL
Match: tr|A0A0A0KM69|A0A0A0KM69_CUCSA (Ferritin OS=Cucumis sativus OX=3659 GN=Csa_5G215130 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.2e-05 Identity = 32/71 (45.07%), Postives = 50/71 (70.42%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TrEMBL
Match: tr|A8D015|A8D015_PYRPY (Ferritin OS=Pyrus pyrifolia OX=3767 GN=Fer4 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 4.1e-04 Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TrEMBL
Match: tr|A0A0G2UGN9|A0A0G2UGN9_9ROSA (Ferritin OS=Pyrus betulifolia OX=436086 GN=Fer4 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 4.1e-04 Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TrEMBL
Match: tr|V7BBA0|V7BBA0_PHAVU (Ferritin OS=Phaseolus vulgaris OX=3885 GN=PHAVU_008G221200g PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 4.1e-04 Identity = 30/71 (42.25%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Cla97C10G190060 vs. Swiss-Prot
Match: sp|Q41709|FRI2_VIGUN (Ferritin-2, chloroplastic OS=Vigna unguiculata OX=3917 GN=PFE2 PE=2 SV=2) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 29/71 (40.85%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of Cla97C10G190060 vs. Swiss-Prot
Match: sp|Q948P6|FRI3_SOYBN (Ferritin-3, chloroplastic OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.5e-05 Identity = 28/71 (39.44%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of Cla97C10G190060 vs. Swiss-Prot
Match: sp|Q948P5|FRI4_SOYBN (Ferritin-4, chloroplastic OS=Glycine max OX=3847 PE=1 SV=2) HSP 1 Score: 47.4 bits (111), Expect = 8.5e-05 Identity = 28/71 (39.44%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of Cla97C10G190060 vs. Swiss-Prot
Match: sp|Q9SRL5|FRI2_ARATH (Ferritin-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FER2 PE=2 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.2e-04 Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of Cla97C10G190060 vs. Swiss-Prot
Match: sp|Q39101|FRI1_ARATH (Ferritin-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FER1 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 4.2e-04 Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TAIR10
Match: AT3G11050.1 (ferritin 2) HSP 1 Score: 45.4 bits (106), Expect = 1.8e-05 Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of Cla97C10G190060 vs. TAIR10
Match: AT5G01600.1 (ferretin 1) HSP 1 Score: 45.1 bits (105), Expect = 2.3e-05 Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |