Cla97C08G152480 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATAAAATCTCTCTTGAAAGTAGGTATCGTGTTGGACTTTAAAATAAATAAAAAATAACCAAGTATTTGGGCCATTTGACAACTATTTTATGTTGTTTTTTTACTTTTTAAATTAAAGTTTATAAACATTATTTTTCACATATAATTTTTTTTTTTTATTTTTGCTATTACTCCCTCTCAATGTTTTAAAAAATCAAGTGAAAACTTGAAAAGTATCTAAAAAGAAACAAGTAAATTTCTAAAACTTGATATGTTTTTAAAAAAATAGATTAAGAAAAATTCTTTGGATTGCAAGAAAAAAAAAAAAGAAACAACTTTGCTGACAATTGTTTGTTTGGTCAGAAGAGTCCTCCGAATATTCGGGTCTTGGATTAATGATCAATATTTTTTTTATTTTTCATTACATTAAAAAAGATATATGAGAATTTTCCAGAAACAATTGCAATAATTGAGCGTGAGAGCCAAATGAATCGAAAGATTCATGTTTGGTTCGGGAAGGGATCGTCGAAGTTTTGAAATGAATGGAAAGACAATCTACTTTCATTAAGTGATTTATTAGATAATCGAAAACAGAGGATCTTGAAAACAATTCAAAATTCAGAAGAACTCCGGGGGGGGGCCATTGAACAGCTGGAAAAAGCCCGGGCCCGCTTACGAAAAGTCGAAATGGAAGCGGATCAGTTTCGAGTGAATGGATACTCTGAGATCGAACGAGAAAAATTGAATTTGATTAATTATATATATATATATATAATTTAG ATGGATAAAATCTCTCTTGAAAATAATCGAAAACAGAGGATCTTGAAAACAATTCAAAATTCAGAAGAACTCCGGGGGGGGGCCATTGAACAGCTGGAAAAAGCCCGGGCCCGCTTACGAAAAGTCGAAATGGAAGCGGATCAGTTTCGAGTGAATGGATACTCTGAGATCGAACGAGAAAAATTGAATTTGATTAATTATATATATATATATATAATTTAG ATGGATAAAATCTCTCTTGAAAATAATCGAAAACAGAGGATCTTGAAAACAATTCAAAATTCAGAAGAACTCCGGGGGGGGGCCATTGAACAGCTGGAAAAAGCCCGGGCCCGCTTACGAAAAGTCGAAATGGAAGCGGATCAGTTTCGAGTGAATGGATACTCTGAGATCGAACGAGAAAAATTGAATTTGATTAATTATATATATATATATATAATTTAG MDKISLENNRKQRILKTIQNSEELRGGAIEQLEKARARLRKVEMEADQFRVNGYSEIEREKLNLINYIYIYII
BLAST of Cla97C08G152480 vs. NCBI nr
Match: AHM88811.1 (ATP synthase CF0 subunit I, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 110.5 bits (275), Expect = 2.4e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. NCBI nr
Match: AHM88926.1 (ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 110.5 bits (275), Expect = 2.4e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. NCBI nr
Match: AHM91109.1 (ATP synthase CF0 subunit I, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 110.5 bits (275), Expect = 2.4e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. NCBI nr
Match: YP_009325975.1 (ATP synthase CF0 B subunit (chloroplast) [Citrullus lanatus] >YP_009348017.1 ATP synthase CF0 B subunit (plastid) [Citrullus mucosospermus] >YP_009420780.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus colocynthis] >YP_009431543.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus amarus] >YP_009431628.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus rehmii] >YP_009456132.1 ATP synthase CF0 B subunit (chloroplast) [Lagenaria siceraria] >APD52466.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus lanatus] >APW82447.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82532.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82617.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82702.1 ATP synthase CF0 B subunit (plastid) [Citrullus mucosospermus] >APW82787.1 ATP synthase CF0 B subunit (plastid) [Citrullus mucosospermus] >APW82872.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82957.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83042.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83127.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83212.1 ATP synthase CF0 B subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83297.1 ATP synthase CF0 B subunit (plastid) [Citrullus mucosospermus] >ASP44465.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus colocynthis] >ASY96162.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus amarus] >ASY96247.1 ATP synthase CF0 B subunit (chloroplast) [Citrullus rehmii] >ASY97461.1 ATP synthase CF0 B subunit (chloroplast) [Cucumis sativus var. hardwickii] >AUJ21898.1 ATP synthase CF0 B subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 110.5 bits (275), Expect = 2.4e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. NCBI nr
Match: YP_247585.1 (ATP synthase CF0 B subunit [Cucumis sativus] >YP_009317372.1 ATP synthase CF0 B subunit (chloroplast) [Coccinia grandis] >YP_009346471.1 ATPase subunit I (chloroplast) [Cucumis x hytivus] >Q4VZP7.1 RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I >CAJ00744.1 ATP synthase CF0 B chain (chloroplast) [Cucumis sativus] >AAZ94638.1 ATPase subunit I (chloroplast) [Cucumis sativus] >ABI97403.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >ABI98731.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >AHM88694.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM88984.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89043.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89102.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89161.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89220.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89279.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89339.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89398.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89457.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89516.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89576.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89635.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89694.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89753.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89812.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89871.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89930.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM89989.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90048.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90107.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90166.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90225.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90284.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90343.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90402.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90461.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90520.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90579.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90638.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90697.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90756.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90815.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90874.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90933.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM90992.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM91051.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >AHM91284.1 ATP synthase CF0 subunit I (chloroplast) [Lagenaria siceraria] >ALF03287.1 ATP synthase CF0 B subunit (chloroplast) [Cucumis sativus var. hardwickii] >ANF28363.1 ATP synthase CF0 B subunit (chloroplast) [Cucumis sativus var. hardwickii] >AOX15201.1 ATPase subunit I (chloroplast) [Cucumis x hytivus] >AOX48737.1 ATP synthase CF0 B subunit (chloroplast) [Coccinia grandis] >AOX48822.1 ATP synthase CF0 B subunit (chloroplast) [Coccinia grandis] >ARQ16064.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >ARQ16147.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >ARQ16230.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >ARQ16313.1 ATP synthase CF0 subunit I (chloroplast) [Cucumis sativus] >AVE15317.1 AtpF (chloroplast) [Cucumis sativus var. sativus]) HSP 1 Score: 110.5 bits (275), Expect = 2.4e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TrEMBL
Match: tr|X2F1Z3|X2F1Z3_LAGSI (ATP synthase subunit b, chloroplastic OS=Lagenaria siceraria OX=3668 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TrEMBL
Match: tr|A0A1P8LD68|A0A1P8LD68_CITLA (ATP synthase CF0 B subunit OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TrEMBL
Match: tr|A0A218KG26|A0A218KG26_CUCSA (ATP synthase subunit b, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TrEMBL
Match: tr|A0A1X9Q1S9|A0A1X9Q1S9_CUCSA (ATP synthase subunit b, chloroplastic OS=Cucumis sativus OX=3659 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TrEMBL
Match: tr|A0A1P8LDX5|A0A1P8LDX5_9ROSI (ATP synthase CF0 B subunit OS=Citrullus mucosospermus OX=519315 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. Swiss-Prot
Match: sp|Q4VZP7|ATPF_CUCSA (ATP synthase subunit b, chloroplastic OS=Cucumis sativus OX=3659 GN=atpF PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 7.8e-24 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C08G152480 vs. Swiss-Prot
Match: sp|A0A321|ATPF_COFAR (ATP synthase subunit b, chloroplastic OS=Coffea arabica OX=13443 GN=atpF PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 5.0e-23 Identity = 58/64 (90.62%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Cla97C08G152480 vs. Swiss-Prot
Match: sp|Q09G60|ATPF_PLAOC (ATP synthase subunit b, chloroplastic OS=Platanus occidentalis OX=4403 GN=atpF PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.5e-22 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Cla97C08G152480 vs. Swiss-Prot
Match: sp|Q14FH1|ATPF_POPAL (ATP synthase subunit b, chloroplastic OS=Populus alba OX=43335 GN=atpF PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-22 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Cla97C08G152480 vs. Swiss-Prot
Match: sp|A4GYP4|ATPF_POPTR (ATP synthase subunit b, chloroplastic OS=Populus trichocarpa OX=3694 GN=atpF PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-22 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of Cla97C08G152480 vs. TAIR10
Match: ATCG00130.1 (ATPase, F0 complex, subunit B/B', bacterial/chloroplast) HSP 1 Score: 95.5 bits (236), Expect = 1.4e-20 Identity = 52/64 (81.25%), Postives = 56/64 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|