Cla97C08G150360 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGAAAAACCGAAGAAGGGAAAAAATTTAGCAACTCAAATTTTAGAGCATGCAAAGTGGTGGTTTTGTTGGGGTGTGAAAGAAGGAAAAGCAATTCCTAAAGATGTTCCAAAGGGTCATTTTGTAGTGTATGTGGGTGAAGAATGGAAGAGATATGTTATTGAGATTGGAGTGTTGAAACATCCTTTGTTTAAGATATTACTTGATTCTGCTGAGGAAATGTTTGGATTTGCTAATGCTTCAAAACTATATTTACCTTGTAAGGAGTGTGTTTTTGTTGGAATTCTTCAATGTCTAGATTCTTCTTCTTCTTTGTAG ATGATGGAAGAAAAACCGAAGAAGGGAAAAAATTTAGCAACTCAAATTTTAGAGCATGCAAAGTGGTGGTTTTGTTGGGGTGTGAAAGAAGGAAAAGCAATTCCTAAAGATGTTCCAAAGGGTCATTTTGTAGTGTATGTGGGTGAAGAATGGAAGAGATATGTTATTGAGATTGGAGTGTTGAAACATCCTTTGTTTAAGATATTACTTGATTCTGCTGAGGAAATGTTTGGATTTGCTAATGCTTCAAAACTATATTTACCTTGTAAGGAGTGTGTTTTTGTTGGAATTCTTCAATGTCTAGATTCTTCTTCTTCTTTGTAG ATGATGGAAGAAAAACCGAAGAAGGGAAAAAATTTAGCAACTCAAATTTTAGAGCATGCAAAGTGGTGGTTTTGTTGGGGTGTGAAAGAAGGAAAAGCAATTCCTAAAGATGTTCCAAAGGGTCATTTTGTAGTGTATGTGGGTGAAGAATGGAAGAGATATGTTATTGAGATTGGAGTGTTGAAACATCCTTTGTTTAAGATATTACTTGATTCTGCTGAGGAAATGTTTGGATTTGCTAATGCTTCAAAACTATATTTACCTTGTAAGGAGTGTGTTTTTGTTGGAATTCTTCAATGTCTAGATTCTTCTTCTTCTTTGTAG MMEEKPKKGKNLATQILEHAKWWFCWGVKEGKAIPKDVPKGHFVVYVGEEWKRYVIEIGVLKHPLFKILLDSAEEMFGFANASKLYLPCKECVFVGILQCLDSSSSL
BLAST of Cla97C08G150360 vs. NCBI nr
Match: XP_004149915.1 (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] >KGN47836.1 hypothetical protein Csa_6G405980 [Cucumis sativus]) HSP 1 Score: 168.3 bits (425), Expect = 1.4e-38 Identity = 85/110 (77.27%), Postives = 95/110 (86.36%), Query Frame = 0
BLAST of Cla97C08G150360 vs. NCBI nr
Match: XP_022959679.1 (auxin-induced protein 15A-like [Cucurbita moschata]) HSP 1 Score: 141.4 bits (355), Expect = 1.8e-30 Identity = 70/105 (66.67%), Postives = 81/105 (77.14%), Query Frame = 0
BLAST of Cla97C08G150360 vs. NCBI nr
Match: XP_022134179.1 (indole-3-acetic acid-induced protein ARG7-like [Momordica charantia]) HSP 1 Score: 134.8 bits (338), Expect = 1.7e-28 Identity = 69/104 (66.35%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of Cla97C08G150360 vs. NCBI nr
Match: XP_008233452.1 (PREDICTED: auxin-induced protein X15-like [Prunus mume]) HSP 1 Score: 110.2 bits (274), Expect = 4.5e-21 Identity = 51/103 (49.51%), Postives = 69/103 (66.99%), Query Frame = 0
BLAST of Cla97C08G150360 vs. NCBI nr
Match: ESR49688.1 (hypothetical protein CICLE_v10033937mg, partial [Citrus clementina]) HSP 1 Score: 108.6 bits (270), Expect = 1.3e-20 Identity = 52/90 (57.78%), Postives = 65/90 (72.22%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TrEMBL
Match: tr|A0A0A0KJ86|A0A0A0KJ86_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G405980 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 9.3e-39 Identity = 85/110 (77.27%), Postives = 95/110 (86.36%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TrEMBL
Match: tr|V4SPJ3|V4SPJ3_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina OX=85681 GN=CICLE_v10033937mg PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 8.7e-21 Identity = 52/90 (57.78%), Postives = 65/90 (72.22%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TrEMBL
Match: tr|A0A2H5PZA1|A0A2H5PZA1_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_178900 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 8.7e-21 Identity = 52/90 (57.78%), Postives = 65/90 (72.22%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TrEMBL
Match: tr|A0A0L9TZ85|A0A0L9TZ85_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan02g187200 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 8.7e-21 Identity = 46/84 (54.76%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TrEMBL
Match: tr|A0A0S3SNT1|A0A0S3SNT1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.08G109400 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 8.7e-21 Identity = 46/84 (54.76%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Cla97C08G150360 vs. Swiss-Prot
Match: sp|P0DKL1|SAU50_HELAN (Auxin-responsive protein SAUR50 OS=Helianthus annuus OX=4232 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 6.9e-13 Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of Cla97C08G150360 vs. Swiss-Prot
Match: sp|O65695|SAU50_ARATH (Auxin-responsive protein SAUR50 OS=Arabidopsis thaliana OX=3702 GN=SAUR50 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 34/61 (55.74%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of Cla97C08G150360 vs. Swiss-Prot
Match: sp|Q9SL45|SAU10_ARATH (Protein SMALL AUXIN UP-REGULATED RNA 10 OS=Arabidopsis thaliana OX=3702 GN=SAUR10 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.5e-10 Identity = 31/65 (47.69%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of Cla97C08G150360 vs. Swiss-Prot
Match: sp|P32295|ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 9.3e-10 Identity = 32/68 (47.06%), Postives = 41/68 (60.29%), Query Frame = 0
BLAST of Cla97C08G150360 vs. Swiss-Prot
Match: sp|P33081|AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-09 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TAIR10
Match: AT2G37030.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.7e-23 Identity = 43/77 (55.84%), Postives = 60/77 (77.92%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TAIR10
Match: AT3G53250.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 91.7 bits (226), Expect = 3.0e-19 Identity = 39/76 (51.32%), Postives = 60/76 (78.95%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TAIR10
Match: AT2G21220.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 77.0 bits (188), Expect = 7.7e-15 Identity = 35/61 (57.38%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TAIR10
Match: AT1G19830.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 74.7 bits (182), Expect = 3.8e-14 Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 0
BLAST of Cla97C08G150360 vs. TAIR10
Match: AT5G20810.2 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 74.7 bits (182), Expect = 3.8e-14 Identity = 32/70 (45.71%), Postives = 47/70 (67.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |