Cla97C08G148980 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAATTCCAGCAGAGAAGCTTATTAAGCTCATAATTATATTATCAACAACTTTGGTTGCGGCGGCGGCGAAGGCGTTAACCGACTGCGATGAACGGTGTGGGAACTTGAAAATTCCATATCCGTTCGGGATGAAGAAAGGGTGTTATCTCAACAAAGATTTCTCCATTACTTGCAACAAAACTCATTATGATCCACCAAAGGCATTTCTTAAAGACACCAACATAGATATCACCAATATATCCATAATCCAAGGCCAACTCCACATCTTGCAATTCGTAGCCAAAGATTGCTATACAAAAAATGGTCCTCGTGAATCCAACACACCAACTCTCGAAGTCTCCGTGTTCACAATTTCCAACACCGACAACAAATTCACAGTCATTGGCTGCGATACTTATGCTTATATTTCTGGTGAACTTGAGGGAGAATCCTACAAAAGTGGGTGCATAGCGTTGTGTGGAACAGTACTAAAGCTATAA ATGAAAATTCCAGCAGAGAAGCTTATTAAGCTCATAATTATATTATCAACAACTTTGGTTGCGGCGGCGGCGAAGGCGTTAACCGACTGCGATGAACGGTGTGGGAACTTGAAAATTCCATATCCGTTCGGGATGAAGAAAGGGTGTTATCTCAACAAAGATTTCTCCATTACTTGCAACAAAACTCATTATGATCCACCAAAGGCATTTCTTAAAGACACCAACATAGATATCACCAATATATCCATAATCCAAGGCCAACTCCACATCTTGCAATTCGTAGCCAAAGATTGCTATACAAAAAATGGTCCTCGTGAATCCAACACACCAACTCTCGAAGTCTCCGTGTTCACAATTTCCAACACCGACAACAAATTCACAGTCATTGGCTGCGATACTTATGCTTATATTTCTGGTGAACTTGAGGGAGAATCCTACAAAAGTGGGTGCATAGCGTTGTGTGGAACAGTACTAAAGCTATAA ATGAAAATTCCAGCAGAGAAGCTTATTAAGCTCATAATTATATTATCAACAACTTTGGTTGCGGCGGCGGCGAAGGCGTTAACCGACTGCGATGAACGGTGTGGGAACTTGAAAATTCCATATCCGTTCGGGATGAAGAAAGGGTGTTATCTCAACAAAGATTTCTCCATTACTTGCAACAAAACTCATTATGATCCACCAAAGGCATTTCTTAAAGACACCAACATAGATATCACCAATATATCCATAATCCAAGGCCAACTCCACATCTTGCAATTCGTAGCCAAAGATTGCTATACAAAAAATGGTCCTCGTGAATCCAACACACCAACTCTCGAAGTCTCCGTGTTCACAATTTCCAACACCGACAACAAATTCACAGTCATTGGCTGCGATACTTATGCTTATATTTCTGGTGAACTTGAGGGAGAATCCTACAAAAGTGGGTGCATAGCGTTGTGTGGAACAGTACTAAAGCTATAA MKIPAEKLIKLIIILSTTLVAAAAKALTDCDERCGNLKIPYPFGMKKGCYLNKDFSITCNKTHYDPPKAFLKDTNIDITNISIIQGQLHILQFVAKDCYTKNGPRESNTPTLEVSVFTISNTDNKFTVIGCDTYAYISGELEGESYKSGCIALCGTVLKL
BLAST of Cla97C08G148980 vs. NCBI nr
Match: XP_008441592.1 (PREDICTED: wall-associated receptor kinase 2-like [Cucumis melo]) HSP 1 Score: 237.7 bits (605), Expect = 2.8e-59 Identity = 120/158 (75.95%), Postives = 134/158 (84.81%), Query Frame = 0
BLAST of Cla97C08G148980 vs. NCBI nr
Match: XP_022989770.1 (wall-associated receptor kinase 2-like [Cucurbita maxima]) HSP 1 Score: 192.2 bits (487), Expect = 1.4e-45 Identity = 86/148 (58.11%), Postives = 117/148 (79.05%), Query Frame = 0
BLAST of Cla97C08G148980 vs. NCBI nr
Match: KGN47508.1 (hypothetical protein Csa_6G349850 [Cucumis sativus]) HSP 1 Score: 185.3 bits (469), Expect = 1.7e-43 Identity = 88/165 (53.33%), Postives = 123/165 (74.55%), Query Frame = 0
BLAST of Cla97C08G148980 vs. NCBI nr
Match: XP_023512416.1 (wall-associated receptor kinase 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 183.3 bits (464), Expect = 6.3e-43 Identity = 88/161 (54.66%), Postives = 120/161 (74.53%), Query Frame = 0
BLAST of Cla97C08G148980 vs. NCBI nr
Match: XP_022960687.1 (wall-associated receptor kinase 3-like [Cucurbita moschata]) HSP 1 Score: 182.2 bits (461), Expect = 1.4e-42 Identity = 86/156 (55.13%), Postives = 118/156 (75.64%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TrEMBL
Match: tr|A0A1S3B3R7|A0A1S3B3R7_CUCME (wall-associated receptor kinase 2-like OS=Cucumis melo OX=3656 GN=LOC103485671 PE=4 SV=1) HSP 1 Score: 237.7 bits (605), Expect = 1.9e-59 Identity = 120/158 (75.95%), Postives = 134/158 (84.81%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TrEMBL
Match: tr|A0A0A0KDE6|A0A0A0KDE6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G349850 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 1.1e-43 Identity = 88/165 (53.33%), Postives = 123/165 (74.55%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TrEMBL
Match: tr|A0A1S3B4E7|A0A1S3B4E7_CUCME (putative wall-associated receptor kinase-like 16 OS=Cucumis melo OX=3656 GN=LOC103485672 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 2.5e-40 Identity = 82/148 (55.41%), Postives = 105/148 (70.95%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TrEMBL
Match: tr|A0A2P5SNX1|A0A2P5SNX1_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD02185 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 2.8e-39 Identity = 79/149 (53.02%), Postives = 106/149 (71.14%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TrEMBL
Match: tr|A0A0D2QMP5|A0A0D2QMP5_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_009G250200 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.7e-39 Identity = 78/152 (51.32%), Postives = 108/152 (71.05%), Query Frame = 0
BLAST of Cla97C08G148980 vs. Swiss-Prot
Match: sp|Q9LMP1|WAK2_ARATH (Wall-associated receptor kinase 2 OS=Arabidopsis thaliana OX=3702 GN=WAK2 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.5e-14 Identity = 46/131 (35.11%), Postives = 74/131 (56.49%), Query Frame = 0
BLAST of Cla97C08G148980 vs. Swiss-Prot
Match: sp|Q39191|WAK1_ARATH (Wall-associated receptor kinase 1 OS=Arabidopsis thaliana OX=3702 GN=WAK1 PE=1 SV=2) HSP 1 Score: 77.4 bits (189), Expect = 1.6e-13 Identity = 47/144 (32.64%), Postives = 74/144 (51.39%), Query Frame = 0
BLAST of Cla97C08G148980 vs. Swiss-Prot
Match: sp|Q9LMN7|WAK5_ARATH (Wall-associated receptor kinase 5 OS=Arabidopsis thaliana OX=3702 GN=WAK5 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 3.9e-12 Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 0
BLAST of Cla97C08G148980 vs. Swiss-Prot
Match: sp|Q9SA25|WAKLG_ARATH (Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana OX=3702 GN=WAKL8 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 8.8e-12 Identity = 47/169 (27.81%), Postives = 82/169 (48.52%), Query Frame = 0
BLAST of Cla97C08G148980 vs. Swiss-Prot
Match: sp|Q9LMN8|WAK3_ARATH (Wall-associated receptor kinase 3 OS=Arabidopsis thaliana OX=3702 GN=WAK3 PE=2 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 1.5e-11 Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TAIR10
Match: AT1G21270.1 (wall-associated kinase 2) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-15 Identity = 46/131 (35.11%), Postives = 74/131 (56.49%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TAIR10
Match: AT1G21250.1 (cell wall-associated kinase) HSP 1 Score: 77.4 bits (189), Expect = 8.8e-15 Identity = 47/144 (32.64%), Postives = 74/144 (51.39%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TAIR10
Match: AT1G21230.1 (wall associated kinase 5) HSP 1 Score: 72.8 bits (177), Expect = 2.2e-13 Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TAIR10
Match: AT1G16260.1 (Wall-associated kinase family protein) HSP 1 Score: 71.6 bits (174), Expect = 4.9e-13 Identity = 47/169 (27.81%), Postives = 82/169 (48.52%), Query Frame = 0
BLAST of Cla97C08G148980 vs. TAIR10
Match: AT1G21240.1 (wall associated kinase 3) HSP 1 Score: 70.9 bits (172), Expect = 8.3e-13 Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|