Cla97C07G136000 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.AGGAATTTGGTGGACAGTCTAGAGTTTTACGCACTGATGTTGGAGTCGTTGGACGCGGCGGGGGCCAGCTGTGAGTGGGTGCGGAGGATTGAAACGTTCGTGGTCCGGCCGAAGATATTGGCGGCGGTTGAAGGGGCTGGGAGAATGGCGGCGCCGCCGTGGAGGGAGGTATTCCACGGTGCCGGGATGAAACCGGTGGCGCTGAGCCAGTTTGCGGATTTCCAAGCGGAGTGCTTACTTGGCAAAATACAGGTTCGAGGGTTCCAAATAGGCAAACGACATGCTGAGCTGGTGCTGTGCTGGCATGAGAGGCCTCTCGTCGCCACGTCGGCTTGGAGGTGCTAA AGGAATTTGGTGGACAGTCTAGAGTTTTACGCACTGATGTTGGAGTCGTTGGACGCGGCGGGGGCCAGCTGTGAGTGGGTGCGGAGGATTGAAACGTTCGTGGTCCGGCCGAAGATATTGGCGGCGGTTGAAGGGGCTGGGAGAATGGCGGCGCCGCCGTGGAGGGAGGTATTCCACGGTGCCGGGATGAAACCGGTGGCGCTGAGCCAGTTTGCGGATTTCCAAGCGGAGTGCTTACTTGGCAAAATACAGGTTCGAGGGTTCCAAATAGGCAAACGACATGCTGAGCTGGTGCTGTGCTGGCATGAGAGGCCTCTCGTCGCCACGTCGGCTTGGAGGTGCTAA AGGAATTTGGTGGACAGTCTAGAGTTTTACGCACTGATGTTGGAGTCGTTGGACGCGGCGGGGGCCAGCTGTGAGTGGGTGCGGAGGATTGAAACGTTCGTGGTCCGGCCGAAGATATTGGCGGCGGTTGAAGGGGCTGGGAGAATGGCGGCGCCGCCGTGGAGGGAGGTATTCCACGGTGCCGGGATGAAACCGGTGGCGCTGAGCCAGTTTGCGGATTTCCAAGCGGAGTGCTTACTTGGCAAAATACAGGTTCGAGGGTTCCAAATAGGCAAACGACATGCTGAGCTGGTGCTGTGCTGGCATGAGAGGCCTCTCGTCGCCACGTCGGCTTGGAGGTGCTAA RNLVDSLEFYALMLESLDAAGASCEWVRRIETFVVRPKILAAVEGAGRMAAPPWREVFHGAGMKPVALSQFADFQAECLLGKIQVRGFQIGKRHAELVLCWHERPLVATSAWRC
BLAST of Cla97C07G136000 vs. NCBI nr
Match: XP_008453725.1 (PREDICTED: scarecrow-like protein 15 [Cucumis melo]) HSP 1 Score: 235.3 bits (599), Expect = 1.0e-58 Identity = 111/114 (97.37%), Postives = 114/114 (100.00%), Query Frame = 0
BLAST of Cla97C07G136000 vs. NCBI nr
Match: KGN53268.1 (GRAS family transcription factor [Cucumis sativus]) HSP 1 Score: 229.9 bits (585), Expect = 4.2e-57 Identity = 110/114 (96.49%), Postives = 113/114 (99.12%), Query Frame = 0
BLAST of Cla97C07G136000 vs. NCBI nr
Match: XP_004146542.2 (PREDICTED: scarecrow-like protein 15 isoform X2 [Cucumis sativus]) HSP 1 Score: 229.9 bits (585), Expect = 4.2e-57 Identity = 110/114 (96.49%), Postives = 113/114 (99.12%), Query Frame = 0
BLAST of Cla97C07G136000 vs. NCBI nr
Match: XP_023552315.1 (scarecrow-like protein 15 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 223.0 bits (567), Expect = 5.1e-55 Identity = 103/114 (90.35%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Cla97C07G136000 vs. NCBI nr
Match: XP_022942043.1 (scarecrow-like protein 15 [Cucurbita moschata]) HSP 1 Score: 222.6 bits (566), Expect = 6.7e-55 Identity = 104/114 (91.23%), Postives = 110/114 (96.49%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TrEMBL
Match: tr|A0A1S3BWY3|A0A1S3BWY3_CUCME (scarecrow-like protein 15 OS=Cucumis melo OX=3656 GN=LOC103494368 PE=3 SV=1) HSP 1 Score: 235.3 bits (599), Expect = 6.6e-59 Identity = 111/114 (97.37%), Postives = 114/114 (100.00%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TrEMBL
Match: tr|A0A0A0KUN9|A0A0A0KUN9_CUCSA (GRAS family transcription factor OS=Cucumis sativus OX=3659 GN=Csa_4G043840 PE=3 SV=1) HSP 1 Score: 229.9 bits (585), Expect = 2.8e-57 Identity = 110/114 (96.49%), Postives = 113/114 (99.12%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TrEMBL
Match: tr|A0A1S3BXR2|A0A1S3BXR2_CUCME (scarecrow-like protein 15 OS=Cucumis melo OX=3656 GN=LOC103494369 PE=3 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 3.3e-50 Identity = 96/113 (84.96%), Postives = 103/113 (91.15%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TrEMBL
Match: tr|A0A0A0KXY2|A0A0A0KXY2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G043830 PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 6.2e-49 Identity = 94/113 (83.19%), Postives = 102/113 (90.27%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TrEMBL
Match: tr|A0A2P4KET3|A0A2P4KET3_QUESU (Scarecrow-like protein 15 OS=Quercus suber OX=58331 GN=CFP56_23764 PE=3 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 8.7e-43 Identity = 87/118 (73.73%), Postives = 103/118 (87.29%), Query Frame = 0
BLAST of Cla97C07G136000 vs. Swiss-Prot
Match: sp|O23210|SCL15_ARATH (Scarecrow-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=SCL15 PE=1 SV=3) HSP 1 Score: 139.0 bits (349), Expect = 3.2e-32 Identity = 72/117 (61.54%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of Cla97C07G136000 vs. Swiss-Prot
Match: sp|O81316|SCL6_ARATH (Scarecrow-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=SCL6 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 9.0e-19 Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 0
BLAST of Cla97C07G136000 vs. Swiss-Prot
Match: sp|Q7XJM8|SCL27_ARATH (Scarecrow-like protein 27 OS=Arabidopsis thaliana OX=3702 GN=SCL27 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 4.5e-18 Identity = 48/114 (42.11%), Postives = 67/114 (58.77%), Query Frame = 0
BLAST of Cla97C07G136000 vs. Swiss-Prot
Match: sp|Q9M000|SCL22_ARATH (Scarecrow-like protein 22 OS=Arabidopsis thaliana OX=3702 GN=SCL22 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.9e-17 Identity = 48/118 (40.68%), Postives = 68/118 (57.63%), Query Frame = 0
BLAST of Cla97C07G136000 vs. Swiss-Prot
Match: sp|Q6EI06|GAIP_CUCMA (DELLA protein GAIP OS=Cucurbita maxima OX=3661 GN=GAIP PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.6e-07 Identity = 36/116 (31.03%), Postives = 58/116 (50.00%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TAIR10
Match: AT4G36710.1 (GRAS family transcription factor) HSP 1 Score: 139.0 bits (349), Expect = 1.8e-33 Identity = 72/117 (61.54%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TAIR10
Match: AT4G00150.1 (GRAS family transcription factor) HSP 1 Score: 94.4 bits (233), Expect = 5.0e-20 Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TAIR10
Match: AT2G45160.1 (GRAS family transcription factor) HSP 1 Score: 92.0 bits (227), Expect = 2.5e-19 Identity = 48/114 (42.11%), Postives = 67/114 (58.77%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TAIR10
Match: AT3G60630.1 (GRAS family transcription factor) HSP 1 Score: 88.6 bits (218), Expect = 2.7e-18 Identity = 48/118 (40.68%), Postives = 68/118 (57.63%), Query Frame = 0
BLAST of Cla97C07G136000 vs. TAIR10
Match: AT1G66350.1 (RGA-like 1) HSP 1 Score: 53.5 bits (127), Expect = 9.7e-08 Identity = 39/115 (33.91%), Postives = 56/115 (48.70%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|