Cla97C07G129060 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAGAAAAAATTGTTCTTCCTTCAGGTTAGTAAGATTTCTCCTTCCCACTTGTGTGTTTTCGAATGATTTTTTGTCAATTTATTTTTCCTTAATATTTTGAATAACTATTTACTTTTTCACCATTTAATTTACCTATAGGGAAATCTTCGTGGCCCGAACTCGTATTCATCGAATCTTCCACTGCAGTATGTCTTATAGAGAGAGATAATCCTAATGTGAAGGTAGTTGTGCTATTAGCTGGATCTCCAGTCACTAAAGATTTAAGGCTAGATCGAGTTCGAGTTTTTGTTAACATAAATAGTGTGGTGGTTAGCGTTCCAACGGTTGGTTGA ATGGCTGAAGAAAAAATTGTTCTTCCTTCAGGGAAATCTTCGTGGCCCGAACTCGTATTCATCGAATCTTCCACTGCAGTATGTCTTATAGAGAGAGATAATCCTAATGTGAAGGTAGTTGTGCTATTAGCTGGATCTCCAGTCACTAAAGATTTAAGGCTAGATCGAGTTCGAGTTTTTGTTAACATAAATAGTGTGGTGGTTAGCGTTCCAACGGTTGGTTGA ATGGCTGAAGAAAAAATTGTTCTTCCTTCAGGGAAATCTTCGTGGCCCGAACTCGTATTCATCGAATCTTCCACTGCAGTATGTCTTATAGAGAGAGATAATCCTAATGTGAAGGTAGTTGTGCTATTAGCTGGATCTCCAGTCACTAAAGATTTAAGGCTAGATCGAGTTCGAGTTTTTGTTAACATAAATAGTGTGGTGGTTAGCGTTCCAACGGTTGGTTGA MAEEKIVLPSGKSSWPELVFIESSTAVCLIERDNPNVKVVVLLAGSPVTKDLRLDRVRVFVNINSVVVSVPTVG
BLAST of Cla97C07G129060 vs. NCBI nr
Match: XP_011654473.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_5G027950 [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 5.0e-19 Identity = 55/75 (73.33%), Postives = 62/75 (82.67%), Query Frame = 0
BLAST of Cla97C07G129060 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_5G286040 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.6e-12 Identity = 41/69 (59.42%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Cla97C07G129060 vs. NCBI nr
Match: ALD47589.1 (serine proteinase inhibitor [Cucumis metulifer]) HSP 1 Score: 77.8 bits (190), Expect = 1.7e-11 Identity = 39/69 (56.52%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Cla97C07G129060 vs. NCBI nr
Match: XP_022975284.1 (inhibitor of trypsin and hageman factor [Cucurbita maxima]) HSP 1 Score: 77.4 bits (189), Expect = 2.3e-11 Identity = 37/64 (57.81%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Cla97C07G129060 vs. NCBI nr
Match: 1MIT_A (Chain A, RECOMBINANT CUCURBITA MAXIMA TRYPSIN INHIBITOR V (RCMTI-V) (NMR, MINIMIZED AVERAGE STRUCTURE)) HSP 1 Score: 76.6 bits (187), Expect = 3.8e-11 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TrEMBL
Match: tr|A0A0A0KPI0|A0A0A0KPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 3.3e-19 Identity = 55/75 (73.33%), Postives = 62/75 (82.67%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TrEMBL
Match: tr|A0A0A0KME7|A0A0A0KME7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.0e-12 Identity = 41/69 (59.42%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TrEMBL
Match: tr|A0A0M3SAG8|A0A0M3SAG8_9ROSI (Serine proteinase inhibitor OS=Cucumis metulifer OX=61886 PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.1e-11 Identity = 39/69 (56.52%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TrEMBL
Match: tr|G7I4R4|G7I4R4_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula OX=3880 GN=11430529 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 9.7e-11 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TrEMBL
Match: tr|A0A2P5VZ93|A0A2P5VZ93_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA36554 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 9.7e-11 Identity = 38/64 (59.38%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Cla97C07G129060 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-13 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C07G129060 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.2e-10 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C07G129060 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-10 Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of Cla97C07G129060 vs. Swiss-Prot
Match: sp|P16231|ICI1_SOLPE (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-10 Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Cla97C07G129060 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-09 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 68.2 bits (165), Expect = 2.5e-12 Identity = 34/63 (53.97%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 55.5 bits (132), Expect = 1.7e-08 Identity = 28/64 (43.75%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C07G129060 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 43.9 bits (102), Expect = 5.0e-05 Identity = 24/63 (38.10%), Postives = 32/63 (50.79%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |