Cla97C06G119070 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCAAAGACTCCCATGCCTATCTTGGCTGGACTAACCCAACCGGCAATTTCCGTCTTCCTGAATTGGGAGAGCAAGAACGAGTCTCTCCTTTTTTTGGGGGCAAAATGATTGTTCTAAAATGGCTATTCCTTACTATTGCTCCTTGTGATGCAGTGGAACCATGGCAATTAGGATCTCAAGACGCAGCAACACCTATGATGCAAGGAATAATAGACTTACATCATGATATCTTTTTCTTCCTCAAGGACGAATTGAATAAGTGAGCATTCATCCCCAATGCCTTCTGTTAAGCTGCTGATACTCTTTCCCTTCGTTTGGCGGCAAGAGTCTTTCAAAAACTCGAGTTCAAGACCTCCGATTCAAATCCGATCGACTAGATCCGATCACATGATCAAGAAACTATTCATGAAGAAGAAGTTCCAGCCGAGAGACTTGTTCTTGCTCTCCCAATTCAGGAAGACGGAAATCGCCGGTTGGGTTGGTCCAACTTTAAGTTTCTCATTACCGCAGGAGTCCGTTTATGAAACATAA ATGCCCAAAGACTCCCATGCCTATCTTGGCTGGACTAACCCAACCGGCAATTTCCGTCTTCCTGAATTGGGAGAGCAAGAACGAGTCTCTCCTTTTTTTGGGGGCAAAATGATTGTTCTAAAATGGCTATTCCTTACTATTGCTCCTTGTGATGCAGTGGAACCATGGCAATTAGGATCTCAAGACGCAGCAACACCTATGATGCAAGGAATAATAGACTTACATCATGATATCTTTTTCTTCCTCAAGGACGAATTGAATAATTCAAGACCTCCGATTCAAATCCGATCGACTAGATCCGATCACATGATCAAGAAACTATTCATGAAGAAGAAGTTCCAGCCGAGAGACTTGTTCTTGCTCTCCCAATTCAGGAAGACGGAAATCGCCGGTTGGGTTGGTCCAACTTTAAGTTTCTCATTACCGCAGGAGTCCGTTTATGAAACATAA ATGCCCAAAGACTCCCATGCCTATCTTGGCTGGACTAACCCAACCGGCAATTTCCGTCTTCCTGAATTGGGAGAGCAAGAACGAGTCTCTCCTTTTTTTGGGGGCAAAATGATTGTTCTAAAATGGCTATTCCTTACTATTGCTCCTTGTGATGCAGTGGAACCATGGCAATTAGGATCTCAAGACGCAGCAACACCTATGATGCAAGGAATAATAGACTTACATCATGATATCTTTTTCTTCCTCAAGGACGAATTGAATAATTCAAGACCTCCGATTCAAATCCGATCGACTAGATCCGATCACATGATCAAGAAACTATTCATGAAGAAGAAGTTCCAGCCGAGAGACTTGTTCTTGCTCTCCCAATTCAGGAAGACGGAAATCGCCGGTTGGGTTGGTCCAACTTTAAGTTTCTCATTACCGCAGGAGTCCGTTTATGAAACATAA MPKDSHAYLGWTNPTGNFRLPELGEQERVSPFFGGKMIVLKWLFLTIAPCDAVEPWQLGSQDAATPMMQGIIDLHHDIFFFLKDELNNSRPPIQIRSTRSDHMIKKLFMKKKFQPRDLFLLSQFRKTEIAGWVGPTLSFSLPQESVYET
BLAST of Cla97C06G119070 vs. NCBI nr
Match: XP_015868752.1 (uncharacterized protein LOC107406162 [Ziziphus jujuba] >XP_015868754.1 uncharacterized protein LOC107406163 [Ziziphus jujuba]) HSP 1 Score: 147.1 bits (370), Expect = 4.7e-32 Identity = 68/90 (75.56%), Postives = 75/90 (83.33%), Query Frame = 0
BLAST of Cla97C06G119070 vs. NCBI nr
Match: PWA94830.1 (cytochrome c oxidase subunit 2, mitochondrion (mitochondrion) [Artemisia annua]) HSP 1 Score: 129.0 bits (323), Expect = 1.3e-26 Identity = 61/78 (78.21%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Cla97C06G119070 vs. NCBI nr
Match: XP_022557896.1 (uncharacterized protein LOC106361778 [Brassica napus]) HSP 1 Score: 104.8 bits (260), Expect = 2.7e-19 Identity = 50/76 (65.79%), Postives = 57/76 (75.00%), Query Frame = 0
BLAST of Cla97C06G119070 vs. NCBI nr
Match: XP_023762953.1 (LOW QUALITY PROTEIN: uncharacterized protein LOC111911403 [Lactuca sativa]) HSP 1 Score: 102.1 bits (253), Expect = 1.7e-18 Identity = 48/60 (80.00%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of Cla97C06G119070 vs. NCBI nr
Match: AHY20296.1 (cytochrome c oxidase subunit 2-1 (mitochondrion) (mitochondrion) [Brassica juncea var. tumida]) HSP 1 Score: 101.7 bits (252), Expect = 2.2e-18 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TrEMBL
Match: tr|A0A2U1Q9Z4|A0A2U1Q9Z4_ARTAN (Cytochrome c oxidase subunit 2, mitochondrion OS=Artemisia annua OX=35608 GN=CTI12_AA016530 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 8.7e-27 Identity = 61/78 (78.21%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TrEMBL
Match: tr|A0A023VX25|A0A023VX25_BRAJU (Cytochrome c oxidase subunit 2 OS=Brassica juncea var. tumida OX=323352 GN=cox2-1 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.5e-18 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TrEMBL
Match: tr|G3EU21|G3EU21_CUCME (Cytochrome c oxidase subunit 2 OS=Cucumis melo subsp. melo OX=412675 GN=cox2 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TrEMBL
Match: tr|G3EJ04|G3EJ04_CUCSA (Cytochrome c oxidase subunit 2 OS=Cucumis sativus OX=3659 GN=cox2 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TrEMBL
Match: tr|A0A0M4N308|A0A0M4N308_9MAGN (Cytochrome c oxidase subunit 2 OS=Heuchera parviflora var. saurensis OX=1708480 GN=cox2 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 4.3e-18 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. Swiss-Prot
Match: sp|P92559|M1280_ARATH (Uncharacterized mitochondrial protein AtMg01280 OS=Arabidopsis thaliana OX=3702 GN=AtMg01280 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 6.2e-20 Identity = 43/46 (93.48%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. Swiss-Prot
Match: sp|P93285|COX2_ARATH (Cytochrome c oxidase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=COX2 PE=1 SV=2) HSP 1 Score: 94.7 bits (234), Expect = 9.0e-19 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of Cla97C06G119070 vs. Swiss-Prot
Match: sp|P98012|COX2_BETVU (Cytochrome c oxidase subunit 2 OS=Beta vulgaris OX=161934 GN=COX2 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 4.5e-18 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of Cla97C06G119070 vs. Swiss-Prot
Match: sp|P08744|COX2_PEA (Cytochrome c oxidase subunit 2 OS=Pisum sativum OX=3888 GN=COX2 PE=3 SV=2) HSP 1 Score: 92.4 bits (228), Expect = 4.5e-18 Identity = 40/43 (93.02%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of Cla97C06G119070 vs. Swiss-Prot
Match: sp|P05491|COX2_SOYBN (Cytochrome c oxidase subunit 2 OS=Glycine max OX=3847 GN=COX2 PE=3 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 9.9e-18 Identity = 39/42 (92.86%), Postives = 40/42 (95.24%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TAIR10
Match: AT2G07695.1 (Cytochrome C oxidase subunit II-like, transmembrane domain) HSP 1 Score: 98.6 bits (244), Expect = 3.5e-21 Identity = 43/46 (93.48%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TAIR10
Match: ATMG00160.1 (cytochrome oxidase 2) HSP 1 Score: 98.6 bits (244), Expect = 3.5e-21 Identity = 43/46 (93.48%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of Cla97C06G119070 vs. TAIR10
Match: ATMG01280.1 (Cytochrome C oxidase subunit II-like, transmembrane domain) HSP 1 Score: 98.6 bits (244), Expect = 3.5e-21 Identity = 43/46 (93.48%), Postives = 45/46 (97.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |