Cla97C06G118830 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAATCTCTTAGGACGTTTGGGCCGCATCGATCAAGCAGTTAATCTAATAAAAAGTATGCCCCATGAACCAGATTTCCTGATGTGGTCCACATTTCTATCTGTTACTGCAACAAAGATAGATTTTGCAAATACAGAAATGGCAGCTAGGCATCTCTTTGAATTGGATCCTAGGTATGCTGTTCCATATGTTATGCTCTCAAATATGTATGCCTCTGTTGGTACATGGAAGGATGTAGCATCAGTTAGGACTCTCGTGAAGACAGAGCAAGAATGTCGAGAAGTTTACTGGGTACAGTTGGATTGA ATGATCAATCTCTTAGGACGTTTGGGCCGCATCGATCAAGCAGTTAATCTAATAAAAAGTATGCCCCATGAACCAGATTTCCTGATGTGGTCCACATTTCTATCTGTTACTGCAACAAAGATAGATTTTGCAAATACAGAAATGGCAGCTAGGCATCTCTTTGAATTGGATCCTAGGTATGCTGTTCCATATGTTATGCTCTCAAATATGTATGCCTCTGTTGGTACATGGAAGGATGTAGCATCAGTTAGGACTCTCGTGAAGACAGAGCAAGAATGTCGAGAAGTTTACTGGGTACAGTTGGATTGA ATGATCAATCTCTTAGGACGTTTGGGCCGCATCGATCAAGCAGTTAATCTAATAAAAAGTATGCCCCATGAACCAGATTTCCTGATGTGGTCCACATTTCTATCTGTTACTGCAACAAAGATAGATTTTGCAAATACAGAAATGGCAGCTAGGCATCTCTTTGAATTGGATCCTAGGTATGCTGTTCCATATGTTATGCTCTCAAATATGTATGCCTCTGTTGGTACATGGAAGGATGTAGCATCAGTTAGGACTCTCGTGAAGACAGAGCAAGAATGTCGAGAAGTTTACTGGGTACAGTTGGATTGA MINLLGRLGRIDQAVNLIKSMPHEPDFLMWSTFLSVTATKIDFANTEMAARHLFELDPRYAVPYVMLSNMYASVGTWKDVASVRTLVKTEQECREVYWVQLD
BLAST of Cla97C06G118830 vs. NCBI nr
Match: XP_022145099.1 (pentatricopeptide repeat-containing protein At4g02750-like [Momordica charantia] >XP_022145100.1 pentatricopeptide repeat-containing protein At4g02750-like [Momordica charantia]) HSP 1 Score: 147.9 bits (372), Expect = 1.9e-32 Identity = 73/104 (70.19%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of Cla97C06G118830 vs. NCBI nr
Match: XP_023516538.1 (pentatricopeptide repeat-containing protein At4g02750-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 147.1 bits (370), Expect = 3.2e-32 Identity = 70/104 (67.31%), Postives = 86/104 (82.69%), Query Frame = 0
BLAST of Cla97C06G118830 vs. NCBI nr
Match: XP_022960689.1 (pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 145.2 bits (365), Expect = 1.2e-31 Identity = 69/104 (66.35%), Postives = 86/104 (82.69%), Query Frame = 0
BLAST of Cla97C06G118830 vs. NCBI nr
Match: XP_022987632.1 (pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 145.2 bits (365), Expect = 1.2e-31 Identity = 70/104 (67.31%), Postives = 85/104 (81.73%), Query Frame = 0
BLAST of Cla97C06G118830 vs. NCBI nr
Match: XP_004147314.1 (PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Cucumis sativus] >KGN64799.1 hypothetical protein Csa_1G103260 [Cucumis sativus]) HSP 1 Score: 140.2 bits (352), Expect = 3.9e-30 Identity = 66/104 (63.46%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TrEMBL
Match: tr|A0A1S4E3A6|A0A1S4E3A6_CUCME (pentatricopeptide repeat-containing protein At4g02750-like OS=Cucumis melo OX=3656 GN=LOC103501362 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 2.6e-30 Identity = 67/104 (64.42%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TrEMBL
Match: tr|A0A0A0LUY3|A0A0A0LUY3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G103260 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 2.6e-30 Identity = 66/104 (63.46%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TrEMBL
Match: tr|A0A2C9WK70|A0A2C9WK70_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_01G124700 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 8.6e-26 Identity = 61/104 (58.65%), Postives = 81/104 (77.88%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TrEMBL
Match: tr|A0A2P5FW66|A0A2P5FW66_9ROSA (DYW domain containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_023160 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 4.3e-25 Identity = 59/104 (56.73%), Postives = 77/104 (74.04%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TrEMBL
Match: tr|A0A2I4HSK7|A0A2I4HSK7_9ROSI (pentatricopeptide repeat-containing protein At3g62890-like OS=Juglans regia OX=51240 GN=LOC109021052 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 4.3e-25 Identity = 59/104 (56.73%), Postives = 80/104 (76.92%), Query Frame = 0
BLAST of Cla97C06G118830 vs. Swiss-Prot
Match: sp|Q9FLZ9|PP405_ARATH (Pentatricopeptide repeat-containing protein At5g39350 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E16 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.4e-16 Identity = 38/88 (43.18%), Postives = 59/88 (67.05%), Query Frame = 0
BLAST of Cla97C06G118830 vs. Swiss-Prot
Match: sp|O22137|PP202_ARATH (Pentatricopeptide repeat-containing protein At2g45350, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRR4 PE=1 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 8.3e-16 Identity = 44/105 (41.90%), Postives = 66/105 (62.86%), Query Frame = 0
BLAST of Cla97C06G118830 vs. Swiss-Prot
Match: sp|P0C8Q8|PP394_ARATH (Pentatricopeptide repeat-containing protein At5g19020, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E42 PE=2 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-14 Identity = 40/98 (40.82%), Postives = 59/98 (60.20%), Query Frame = 0
BLAST of Cla97C06G118830 vs. Swiss-Prot
Match: sp|Q9LNU6|PPR53_ARATH (Pentatricopeptide repeat-containing protein At1g20230 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H21 PE=2 SV=2) HSP 1 Score: 79.7 bits (195), Expect = 2.0e-14 Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of Cla97C06G118830 vs. Swiss-Prot
Match: sp|Q9FFG8|PP417_ARATH (Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H17 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.6e-14 Identity = 42/101 (41.58%), Postives = 59/101 (58.42%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TAIR10
Match: AT5G39350.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 84.7 bits (208), Expect = 3.5e-17 Identity = 38/88 (43.18%), Postives = 59/88 (67.05%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TAIR10
Match: AT2G45350.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 84.3 bits (207), Expect = 4.6e-17 Identity = 44/105 (41.90%), Postives = 66/105 (62.86%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TAIR10
Match: AT5G19020.1 (mitochondrial editing factor 18) HSP 1 Score: 80.1 bits (196), Expect = 8.7e-16 Identity = 40/98 (40.82%), Postives = 59/98 (60.20%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TAIR10
Match: AT1G20230.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 1.1e-15 Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of Cla97C06G118830 vs. TAIR10
Match: AT5G44230.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 2.5e-15 Identity = 42/101 (41.58%), Postives = 59/101 (58.42%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|